Transcription Factor
Accessions: | NKX2-8 (HT-SELEX2 May2017), NKX28_HUMAN (HOCOMOCO 10), O15522 (JASPAR 2024) |
Names: | ENSG00000136327, NKX2-8, Homeobox protein NK-2 homolog H, Homeobox protein Nkx-2.8, NKX28_HUMAN |
Organisms: | Homo sapiens |
Libraries: | HT-SELEX2 May2017 1, HOCOMOCO 10 2, JASPAR 2024 3 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Uniprot: | O15522 |
Notes: | TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3 |
Length: | 239 |
Pfam Domains: | 85-141 Homeobox domain |
Sequence: (in bold interface residues) | 1 MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLE 60 61 TSPPDSSQRPSARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASL 120 121 LRLTPTQVKIWFQNHRYKLKRARAPGAAESPDLAASAELHAAPGLLRRVVVPVLVRDGQP 180 181 CGGGGGGEVGTAAAQEKCGAPPAAACPLPGYPAFGPGSALGLFPAYQHLASPALVSWNW |
Interface Residues: | 84, 85, 86, 87, 88, 126, 127, 129, 130, 133, 134, 137, 138, 141, 142, 143 |
3D-footprint Homologues: | 4j19_B, 2h1k_B, 1puf_A, 6a8r_A, 3cmy_A, 1fjl_B, 3d1n_M, 5zfz_A, 1zq3_P, 3lnq_A, 1jgg_B, 2lkx_A, 1nk2_P, 2ld5_A, 7q3o_C, 1puf_B, 6es3_K, 6m3d_C, 5flv_I, 5zjt_E, 3a01_E, 7psx_B, 3rkq_B, 2hdd_A, 1au7_A, 5jlw_D, 4cyc_A, 2r5y_A, 4xrs_G, 2hos_A, 1b72_A, 2xsd_C, 1ig7_A, 1e3o_C, 1le8_A, 7xrc_C, 1o4x_A, 1du0_A, 4qtr_D, 5hod_A, 4xrm_B |
Binding Motifs: | MA0673.1 sCACTYsAr NKX2-8_4 rsCACTYgAv NKX2-8_methyl_1 rsCACTTgAr NKX2-8_methyl_2 GATGTCGTTAyTGC NKX2-8_methyl_3 sTCGTTgAr NKX28_HUMAN.H10MO.C|M01376 tTCAAGkrc MA0673.2 sCACTYsA |
Publications: | Kasahara H., Usheva A., Ueyama T., Aoki H., Horikoshi N., Izumo S. Characterization of homo- and heterodimerization of cardiac Csx/Nkx2.5 homeoprotein. J. Biol. Chem. 276:4570-4580 (2001). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.