Transcription Factor

Accessions: T03956 (AthalianaCistrome v4_May2016), Q6S592 (JASPAR 2024)
Names: AT1G13400, JGL, T03956;, JGL_ARATH, Zinc finger protein JAGGED-like, Zinc finger protein NUBBIN
Organisms: Arabidopsis thaliana
Libraries: AthalianaCistrome v4_May2016 1, JASPAR 2024 2
1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: ecotype:Col-0, experiment type: DAP-seq, family:C2H2
Length: 207
Sequence:
(in bold interface residues)
1 MRADENNTLDLNNLPDDPSRDIFPFFEEGFSSSSSSGGFREKQTKDGKEYECRFCSLKFF 60
61 KSQALGGHMNRHRQERETESLNKARELVLRNDSFPPHQGPPSFSYHQGDVHIGDLTQFKP 120
121 MMYPPRHFSLPGSSSILQLQPPYLYPPLSSPFPQHNTNIGNNGTRHQTLTNSVCGGRALP 180
181 DSSYTFIGAPVANGSRVAPHLPPHHGL
Interface Residues: 8, 32, 34, 35, 37, 39, 40, 43, 60, 61, 62, 63, 64, 66, 67, 68
3D-footprint Homologues: 5yel_A, 5k5i_A, 5kkq_D, 1g2f_F, 2wbs_A, 1f2i_J, 4x9j_A, 5yj3_D, 8h9h_G, 7n5w_A, 1llm_D, 8gh6_A, 7y3m_I
Binding Motifs: M0323 AmytyCAGTTm
UN0403.1 AmytyCAGTTm
UN0403.2 AmytyCAGTT
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.