Transcription Factor
| Accessions: | 5vmu_A (3D-footprint 20260701), 5vmw_A (3D-footprint 20260701), 5vmy_A (3D-footprint 20260701) |
| Names: | KAISO_HUMAN, Transcriptional regulator Kaiso, Zinc finger and BTB domain-containing protein 33 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Length: | 121 |
| Pfam Domains: | 28-51 Zinc-finger double domain 42-64 C2H2-type zinc finger 58-80 Zinc-finger double domain 70-93 Zinc finger, C2H2 type 70-93 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKH 60 61 EIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYL 120 121 S |
| Interface Residues: | 14, 24, 25, 26, 27, 28, 30, 31, 33, 34, 37, 52, 53, 54, 55, 56, 58, 59, 60, 80, 81, 82, 83, 84, 85, 86, 87, 88, 91, 115, 117 |
| 3D-footprint Homologues: | 2kmk_A, 1tf3_A, 7n5w_A, 6jnm_A, 6ml4_A, 6e94_A, 5kkq_D, 4x9j_A, 2gli_A, 5kl3_A, 1tf6_A, 5ei9_F, 1g2f_F, 7ysf_A, 1ubd_C, 8ssq_A, 7w1m_H, 6blw_A, 5k5i_A, 6u9q_A, 2drp_D, 8ssu_A, 8h9h_G, 5v3j_F, 2lt7_A, 8gn3_A, 6a57_A, 2jpa_A, 7y3l_A, 3uk3_C, 8cuc_F, 1f2i_J, 2wbs_A, 7txc_E, 1llm_D, 5yel_A, 4m9v_C, 7y3m_I, 5yj3_D |
| Binding Motifs: | 5vmu_A tnnnnGga 5vmw_A TCCcGcGA 5vmy_A TCGCGGGA |
| Binding Sites: | 5vmw_D 5vmy_E 5vmw_E 5vmu_D / 5vmy_D 5vmu_E |
| Publications: | Nikolova EN, Stanfield RL, Dyson HJ, Wright PE. CH···O Hydrogen Bonds Mediate Highly Specific Recognition of Methylated CpG Sites by the Zinc Finger Protein Kaiso. Biochemistry 57:2109-2120 (2018). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.