Transcription Factor

Accessions: 5vmu_A (3D-footprint 20260701), 5vmw_A (3D-footprint 20260701), 5vmy_A (3D-footprint 20260701)
Names: KAISO_HUMAN, Transcriptional regulator Kaiso, Zinc finger and BTB domain-containing protein 33
Organisms: Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 121
Pfam Domains: 28-51 Zinc-finger double domain
42-64 C2H2-type zinc finger
58-80 Zinc-finger double domain
70-93 Zinc finger, C2H2 type
70-93 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKH 60
61 EIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYL 120
121 S
Interface Residues: 14, 24, 25, 26, 27, 28, 30, 31, 33, 34, 37, 52, 53, 54, 55, 56, 58, 59, 60, 80, 81, 82, 83, 84, 85, 86, 87, 88, 91, 115, 117
3D-footprint Homologues: 2kmk_A, 1tf3_A, 7n5w_A, 6jnm_A, 6ml4_A, 6e94_A, 5kkq_D, 4x9j_A, 2gli_A, 5kl3_A, 1tf6_A, 5ei9_F, 1g2f_F, 7ysf_A, 1ubd_C, 8ssq_A, 7w1m_H, 6blw_A, 5k5i_A, 6u9q_A, 2drp_D, 8ssu_A, 8h9h_G, 5v3j_F, 2lt7_A, 8gn3_A, 6a57_A, 2jpa_A, 7y3l_A, 3uk3_C, 8cuc_F, 1f2i_J, 2wbs_A, 7txc_E, 1llm_D, 5yel_A, 4m9v_C, 7y3m_I, 5yj3_D
Binding Motifs: 5vmu_A tnnnnGga
5vmw_A TCCcGcGA
5vmy_A TCGCGGGA
Binding Sites: 5vmw_D
5vmy_E
5vmw_E
5vmu_D / 5vmy_D
5vmu_E
Publications: Nikolova EN, Stanfield RL, Dyson HJ, Wright PE. CH···O Hydrogen Bonds Mediate Highly Specific Recognition of Methylated CpG Sites by the Zinc Finger Protein Kaiso. Biochemistry 57:2109-2120 (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.