Transcription Factor

Accessions: 4yg1_B (3D-footprint 20250804), 4yg1_C (3D-footprint 20250804), 4yg4_A (3D-footprint 20250804), 4yg4_C (3D-footprint 20250804), 4yg4_D (3D-footprint 20250804), 4yg7_B (3D-footprint 20250804), 4yg7_E (3D-footprint 20250804)
Names: Antitoxin HipB, HIPB_ECOLI
Organisms: Escherichia coli, strain K12
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P23873
Length: 69
Pfam Domains: 9-64 Helix-turn-helix domain
9-62 Helix-turn-helix domain
13-64 Helix-turn-helix domain
15-66 Helix-turn-helix
19-64 Cro/C1-type HTH DNA-binding domain
Sequence:
(in bold interface residues)
1 FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQS 60
61 LELSMTLCD
Interface Residues: 25, 26, 35, 36, 37, 38, 40, 41, 44, 47, 48
3D-footprint Homologues: 3oqm_C, 1per_L, 3cro_R, 3zkc_A, 5k98_B, 3dnv_B, 4z5h_A, 5gpc_B, 4lln_I
Binding Motifs: 4yg1_ABCD TATCnnnnnnnATGnTAnnnnnnnnnnnATnCnnnnnnCGGATA
4yg1_B GATA
4yg4_ABCD ATaCnnnnnnngGGA
4yg7_BCDEGK TAnCCnnnnngGATAnnnnnnnnnnTAnnCCnnnnnGGGAT
Binding Sites: 4yg1_F
4yg1_T
4yg4_F
4yg4_T
Publications: Schumacher MA, Balani P, Min J, Chinnam NB, Hansen S, Vulić M, Lewis K, Brennan RG. HipBA-promoter structures reveal the basis of heritable multidrug tolerance. Nature 524:59-64 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.