Transcription Factor

						

			
Accessions: 3m9e_A (3D-footprint 20231221)

			
Names: c-erbA-2, c-erbA-beta, Nuclear receptor subfamily 1 group A member 2, THB_RAT, Thyroid hormone receptor beta
Organisms: Rattus norvegicus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P18113
Length: 101
Pfam Domains:      2-71 Zinc finger, C4 type (two domains)
Sequence: 
(in bold interface residues)		   1 ELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKSLHPSYSCKYEGKCIIDKVTRNQCQEC   60
  61 RFKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREELQ
Interface Residues: 11, 12, 14, 15, 21, 22, 24, 25, 28, 29, 55, 79, 81, 84
3D-footprint Homologues: 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A
Binding Motifs: 3m9e_AB TGACCtnnnnnnrGGTCA
			
Publications: Chen Y, Young M.A. Structure of a thyroid hormone receptor DNA-binding domain homodimer bound to an inverted palindrome DNA response element. Molecular endocrinology (Baltimore, Md.) 24:1650-64 (2010). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.