Transcription Factor
Accessions: | 5z2t_C (3D-footprint 20241219) |
Names: | Double homeobox protein 10, Double homeobox protein 4, DUX4_HUMAN |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Length: | 53 |
Pfam Domains: | 1-52 Homeobox domain 21-51 Homeobox KN domain |
Sequence: (in bold interface residues) | 1 RTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHP |
Interface Residues: | 1, 10, 11, 14, 39, 40, 42, 43, 46, 47, 49, 50, 51 |
3D-footprint Homologues: | 8osb_E, 7q3o_C, 2lkx_A, 8eml_B, 6es3_K, 2hdd_A, 4cyc_A, 2hos_A, 8pmf_A, 8ik5_C, 7psx_B, 2ld5_A, 9b8u_A, 8ejp_B, 4f43_A, 4e0g_A, 8pi8_B, 7xrc_C, 1zq3_P, 8g87_X, 8bx1_A, 6m3d_C |
Binding Motifs: | 5z2t_CD TTAsaTTA |
Publications: | Dong X, Zhang W, Wu H, Huang J, Zhang M, Wang P, Zhang H, Chen Z, Chen SJ, Meng G. Structural basis of DUX4/IGH-driven transactivation. Leukemia : (2018). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.