Transcription Factor

Accessions: 5z2t_C (3D-footprint 20250804)
Names: Double homeobox protein 10, Double homeobox protein 4, DUX4_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 53
Pfam Domains: 1-52 Homeobox domain
21-51 Homeobox KN domain
Sequence:
(in bold interface residues)
1 RTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHP
Interface Residues: 1, 10, 11, 14, 39, 40, 42, 43, 46, 47, 49, 50, 51
3D-footprint Homologues: 5jlw_D, 3a01_E, 6es3_K, 4xrs_G, 3rkq_B, 2ld5_A, 8pmf_A, 1au7_A, 5zfz_A, 3cmy_A, 8ik5_C, 1fjl_B, 5flv_I, 4cyc_A, 2lkx_A, 9b8u_A, 1nk2_P, 8ejp_B, 1b72_A, 5zjt_E, 3d1n_M, 2hdd_A, 8osb_E, 1ig7_A, 7psx_B, 5hod_A, 2r5y_A, 1puf_A, 8eml_B, 6a8r_A, 3lnq_A, 2hos_A, 1jgg_B, 7q3o_C, 4f43_A, 4e0g_A, 1e3o_C, 1le8_A, 4j19_B, 8pi8_B, 1puf_B, 8g87_X, 8bx1_A, 1zq3_P, 4qtr_D, 1du0_A, 4xrm_B, 6m3d_C
Binding Motifs: 5z2t_CD TTAsaTTA
Publications: Dong X, Zhang W, Wu H, Huang J, Zhang M, Wang P, Zhang H, Chen Z, Chen SJ, Meng G. Structural basis of DUX4/IGH-driven transactivation. Leukemia : (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.