Transcription Factor
| Accessions: | HES6 (HT-SELEX2 May2017), Q96HZ4 (JASPAR 2024) |
| Names: | ENSG00000144485, HES6, bHLHb41, C-HAIRY1, Class B basic helix-loop-helix protein 41, Hairy and enhancer of split 6, HES6_HUMAN, Transcription cofactor HES-6 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1, JASPAR 2024 2 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | TF family: bHLH experiment: HT-SELEX Hamming distance: 1 cycle: 3 |
| Length: | 224 |
| Pfam Domains: | 26-73 Helix-loop-helix DNA-binding domain 94-134 Hairy Orange |
| Sequence: (in bold interface residues) | 1 MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAK 60 61 LENAEVLELTVRRVQGVLRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDAT 120 121 VAAELLNHLLESMPLREGSSFQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPGPGDD 180 181 LCSDLEEAPEAELSQAPAEGPDLVPAALGSLTTAQIARSVWRPW |
| Interface Residues: | 30, 31, 33, 34, 37, 38 |
| 3D-footprint Homologues: | 1am9_A, 4h10_A, 2ypa_A |
| Binding Motifs: | HES6_1 / MA1493.1 GGCACGTGTy |
| Publications: | Cossins J, Vernon AE, Zhang Y, Philpott A, Jones PH. Hes6 regulates myogenic differentiation. Development 129:2195-207 (2002). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.