Transcription Factor
Accessions: | 2nll_B (3D-footprint 20241219) |
Names: | c-erbA-2, c-erbA-beta, Nuclear receptor subfamily 1 group A member 2, THB_HUMAN, THYROID HORMONE RECEPTOR, Thyroid hormone receptor beta |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P10828 |
Length: | 103 |
Pfam Domains: | 3-72 Zinc finger, C4 type (two domains) |
Sequence: (in bold interface residues) | 1 DELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQE 60 61 CRFKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREELEK |
Interface Residues: | 13, 15, 22, 25, 26, 29, 30, 56, 82, 85 |
3D-footprint Homologues: | 7wnh_D, 6l6q_B, 3g9m_B, 2nll_B, 8hbm_B, 2ff0_A, 7xv6_B, 2han_A, 7xvn_C, 2han_B, 8cef_H, 2a66_A, 5cbz_E, 3g6t_A, 8rm6_A, 7prw_B, 5cbx_B |
Binding Motifs: | 2nll_AB GGtnAnnnnaGGTCA 2nll_B hGACCy |
Binding Sites: | 2nll_D 2nll_C |
Publications: | Rastinejad F., Perlmann T., Evans R. M., Sigler P. B. Structural determinants of nuclear receptor assembly on DNA direct repeats. Nature 375:203-211 (1995). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.