Transcription Factor

Accessions: HOXA2 (HT-SELEX2 May2017)
Names: ENSG00000105996, HOXA2
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2
Length: 151
Pfam Domains: 72-128 Homeobox domain
Sequence:
(in bold interface residues)
1 PKPSPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGPACLSHKES 60
61 LEIADGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQ 120
121 NRRMKHKRQTQCKENQNSEGKCKSLEDSEKV
Interface Residues: 72, 73, 74, 75, 111, 112, 113, 114, 116, 117, 120, 121, 123, 124, 125, 128
3D-footprint Homologues: 8ejp_B, 8pmf_A, 2glo_A, 1zq3_P, 2lkx_A, 2ld5_A, 7psx_B, 2hdd_A, 4cyc_A, 8osb_E, 7q3o_C, 2hos_A, 8eml_B, 6es3_K, 6m3d_C, 9b8u_A, 8ik5_C, 7xrc_C, 8g87_X, 8bx1_A
Binding Motifs: HOXA2_3 symATTAs
HOXA2_6 sTMATTAs
HOXA2_methyl_1 sTAATTAs
HOXA2_methyl_2 rTCrTTAr
HOXA2_methyl_4 sTMATTAs
HOXA2_methyl_5 rTCrTTAr
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.