Transcription Factor
| Accessions: | HOXA2 (HT-SELEX2 May2017) |
| Names: | ENSG00000105996, HOXA2 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2 |
| Length: | 151 |
| Pfam Domains: | 72-128 Homeobox domain |
| Sequence: (in bold interface residues) | 1 PKPSPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGPACLSHKES 60 61 LEIADGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQ 120 121 NRRMKHKRQTQCKENQNSEGKCKSLEDSEKV |
| Interface Residues: | 72, 73, 74, 75, 113, 114, 116, 117, 120, 121, 124, 125, 128 |
| 3D-footprint Homologues: | 6a8r_A, 2h1k_B, 1puf_A, 3cmy_A, 5zfz_A, 1fjl_B, 3d1n_M, 1zq3_P, 1jgg_B, 3lnq_A, 2lkx_A, 1nk2_P, 2ld5_A, 1b72_A, 5zjt_E, 4cyc_A, 1ig7_A, 7psx_B, 5hod_A, 3l1p_A, 3a01_E, 7q3o_C, 5jlw_D, 6es3_K, 4xrs_G, 2hdd_A, 3rkq_B, 2r5y_A, 1puf_B, 6m3d_C, 5flv_I, 2hos_A, 2xsd_C, 1e3o_C, 1le8_A, 7xrc_C, 1au7_A, 1o4x_A, 1du0_A, 4qtr_D, 8g87_X |
| Binding Motifs: | HOXA2_3 symATTAs HOXA2_6 sTMATTAs HOXA2_methyl_1 sTAATTAs HOXA2_methyl_2 rTCrTTAr HOXA2_methyl_4 sTMATTAs HOXA2_methyl_5 rTCrTTAr |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.