Transcription Factor
Accessions: | 2a66_A (3D-footprint 20241219) |
Names: | Alpha-1-fetoprotein transcription factor, B1-binding factor, CYP7A promoter-binding factor, hB1F, Hepatocytic transcription factor, Liver receptor homolog 1, LRH-1, NR5A2_HUMAN, Nuclear receptor subfamily 5 group A member 2, Orphan nuclear receptor NR5A2 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | O00482 |
Length: | 95 |
Pfam Domains: | 2-69 Zinc finger, C4 type (two domains) |
Sequence: (in bold interface residues) | 1 ELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRF 60 61 QKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRAL |
Interface Residues: | 9, 12, 13, 14, 15, 21, 24, 25, 28, 29, 53, 75, 77, 79, 82, 84 |
3D-footprint Homologues: | 8dwj_A, 7wnh_D, 6l6q_B, 3g9m_B, 2nll_B, 2ff0_A, 7xv6_B, 8hbm_B, 2han_A, 7xvn_C, 2han_B, 8cef_H, 2a66_A, 5cbz_E, 3g6t_A, 8rm6_A, 7prw_B, 5cbx_B |
Binding Motifs: | 2a66_A TGnCCTTGA |
Binding Sites: | 2a66_B 2a66_C |
Publications: | Solomon I.H, Hager J.M, Safi R, McDonnell D.P, Redinbo M.R, Ortlund E.A. Crystal structure of the human LRH-1 DBD-DNA complex reveals Ftz-F1 domain positioning is required for receptor activity. Journal of molecular biology 354:1091-102 (2005). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.