Transcription Factor

						

			
Accessions: 5eh2_F (3D-footprint 20231221)

			
Names: [histone H3]-lysine36 N-trimethyltransferase PRDM9, [histone H3]-lysine4 N-trimethyltransferase PRDM9, [histone H3]-lysine9 N-trimethyltransferase PRDM9, [histone H4]-lysine20 N-methyltransferase PRDM9, [histone H4]-N-methyl-L-lysine20 N-methyltransferase PRDM9, EC 2.1.1.-, EC 2.1.1.354, EC 2.1.1.355, EC 2.1.1.359, EC 2.1.1.361, EC 2.1.1.362, Histone-lysine N-methyltransferase PRDM9, PR domain zinc finger protein 9, PR domain-containing protein 9, PRDM9_HUMAN, Protein-lysine N-methyltransferase PRDM9
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9NQV7
Length: 109
Pfam Domains:      2-24 C2H2-type zinc finger
     2-24 C2H2-type zinc finger
     2-24 Zinc finger, C2H2 type
    16-39 Zinc-finger double domain
    30-52 C2H2-type zinc finger
    30-52 C2H2-type zinc finger
    30-52 Zinc finger, C2H2 type
    44-67 Zinc-finger double domain
    58-80 Zinc finger, C2H2 type
    58-80 C2H2-type zinc finger
    58-80 C2H2-type zinc finger
    72-97 Zinc-finger double domain
   86-108 C2H2-type zinc finger
   86-108 Zinc finger, C2H2 type
   86-108 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 PYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRDKSHLLRHQRTHTGEKPYVC   60
  61 RECGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFSNKSHLLRHQRTHT
Interface Residues: 2, 12, 13, 14, 15, 16, 18, 19, 21, 22, 25, 40, 41, 42, 43, 44, 46, 47, 48, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 80, 96, 97, 98, 99, 100, 102, 103
3D-footprint Homologues: 2kmk_A, 6jnm_A, 5v3j_F, 1tf3_A, 8ssu_A, 2gli_A, 5k5l_F, 1tf6_A, 7w1m_H, 1llm_D, 5kkq_D, 5ei9_F, 8ssq_A, 6u9q_A, 1f2i_J, 5k5i_A, 7eyi_G, 6e94_A, 7ysf_A, 6wmi_A, 2lt7_A, 2i13_A, 2jpa_A, 1ubd_C, 8cuc_F, 7y3l_A, 7n5w_A, 3uk3_C, 5und_A, 1g2f_F, 4x9j_A, 6blw_A, 6ml4_A, 5yel_A, 1mey_C, 5kl3_A, 2drp_D, 4m9v_C, 8h9h_G, 7y3m_I, 6a57_A, 8gn3_A, 2wbs_A, 7txc_E, 8ebt_K, 8ebx_K, 6dta_B, 5yj3_D
Binding Motifs: 5eh2_F mCTCCCTAGCCa
Binding Sites: 5eh2_C
5eh2_D
			
Publications: Patel A, Horton JR, Wilson GG, Zhang X, Cheng X. Structural basis for human PRDM9 action at recombination hot spots. Genes Dev 30:257-65 (2016). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.