Transcription Factor

Accessions: 5eh2_F (3D-footprint 20241219)
Names: [histone H3]-lysine36 N-trimethyltransferase PRDM9, [histone H3]-lysine4 N-trimethyltransferase PRDM9, [histone H3]-lysine9 N-trimethyltransferase PRDM9, [histone H4]-lysine20 N-methyltransferase PRDM9, [histone H4]-N-methyl-L-lysine20 N-methyltransferase PRDM9, EC 2.1.1.-, EC 2.1.1.354, EC 2.1.1.355, EC 2.1.1.359, EC 2.1.1.361, EC 2.1.1.362, Histone-lysine N-methyltransferase PRDM9, PR domain zinc finger protein 9, PR domain-containing protein 9, PRDM9_HUMAN, Protein-lysine N-methyltransferase PRDM9
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9NQV7
Length: 109
Pfam Domains: 2-24 C2H2-type zinc finger
2-24 C2H2-type zinc finger
2-24 Zinc finger, C2H2 type
16-39 Zinc-finger double domain
30-52 C2H2-type zinc finger
30-52 C2H2-type zinc finger
30-52 Zinc finger, C2H2 type
44-67 Zinc-finger double domain
58-80 C2H2-type zinc finger
58-80 C2H2-type zinc finger
58-80 Zinc finger, C2H2 type
72-97 Zinc-finger double domain
86-108 Zinc finger, C2H2 type
86-108 C2H2-type zinc finger
86-108 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 PYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRDKSHLLRHQRTHTGEKPYVC 60
61 RECGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFSNKSHLLRHQRTHT
Interface Residues: 2, 12, 13, 14, 15, 16, 18, 19, 21, 22, 25, 40, 41, 42, 43, 44, 46, 47, 68, 69, 70, 71, 72, 75, 77, 80, 97, 98, 99, 100, 102, 103
3D-footprint Homologues: 2kmk_A, 1tf3_A, 5v3j_F, 1tf6_A, 8ssq_A, 8ssu_A, 7w1m_H, 6u9q_A, 2gli_A, 7ysf_A, 6e94_A, 2lt7_A, 2jpa_A, 1ubd_C, 7n5w_A, 8cuc_F, 7y3l_A, 2drp_D, 8h9h_G, 7y3m_I, 7txc_E, 8gn3_A, 8ebt_K, 8ebx_K, 6dta_B
Binding Motifs: 5eh2_F mCTCCCTAGCCa
Binding Sites: 5eh2_C
5eh2_D
Publications: Patel A, Horton JR, Wilson GG, Zhang X, Cheng X. Structural basis for human PRDM9 action at recombination hot spots. Genes Dev 30:257-65 (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.