Transcription Factor
| Accessions: | 5eh2_F (3D-footprint 20250804) |
| Names: | [histone H3]-lysine36 N-trimethyltransferase PRDM9, [histone H3]-lysine4 N-trimethyltransferase PRDM9, [histone H3]-lysine9 N-trimethyltransferase PRDM9, [histone H4]-lysine20 N-methyltransferase PRDM9, [histone H4]-N-methyl-L-lysine20 N-methyltransferase PRDM9, EC 2.1.1.-, EC 2.1.1.354, EC 2.1.1.355, EC 2.1.1.359, EC 2.1.1.361, EC 2.1.1.362, Histone-lysine N-methyltransferase PRDM9, PR domain zinc finger protein 9, PR domain-containing protein 9, PRDM9_HUMAN, Protein-lysine N-methyltransferase PRDM9 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q9NQV7 |
| Length: | 109 |
| Pfam Domains: | 2-24 C2H2-type zinc finger 2-24 C2H2-type zinc finger 2-24 Zinc finger, C2H2 type 16-39 Zinc-finger double domain 30-52 C2H2-type zinc finger 30-52 C2H2-type zinc finger 30-52 Zinc finger, C2H2 type 44-67 Zinc-finger double domain 58-80 Zinc finger, C2H2 type 58-80 C2H2-type zinc finger 58-80 C2H2-type zinc finger 72-97 Zinc-finger double domain 86-108 C2H2-type zinc finger 86-108 Zinc finger, C2H2 type 86-108 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 PYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRDKSHLLRHQRTHTGEKPYVC 60 61 RECGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFSNKSHLLRHQRTHT |
| Interface Residues: | 2, 12, 13, 14, 15, 16, 18, 19, 21, 22, 25, 40, 41, 42, 43, 44, 46, 47, 48, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 80, 96, 97, 98, 99, 100, 102, 103 |
| 3D-footprint Homologues: | 2kmk_A, 6jnm_A, 5v3j_F, 1tf3_A, 6u9q_A, 5ei9_F, 5k5i_A, 8ssq_A, 1llm_D, 5k5l_F, 8ssu_A, 2gli_A, 1f2i_J, 7w1m_H, 5kkq_D, 1tf6_A, 6e94_A, 2lt7_A, 7ysf_A, 2jpa_A, 1ubd_C, 7y3l_A, 3uk3_C, 7n5w_A, 8cuc_F, 1g2f_F, 5kl3_A, 2drp_D, 6blw_A, 6ml4_A, 5yel_A, 4x9j_A, 8h9h_G, 4m9v_C, 7y3m_I, 6a57_A, 7txc_E, 8gn3_A, 2wbs_A, 8ebt_K, 8ebx_K, 6dta_B, 5yj3_D |
| Binding Motifs: | 5eh2_F mCTCCCTAGCCa |
| Binding Sites: | 5eh2_C 5eh2_D |
| Publications: | Patel A, Horton JR, Wilson GG, Zhang X, Cheng X. Structural basis for human PRDM9 action at recombination hot spots. Genes Dev 30:257-65 (2016). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.