Transcription Factor
| Accessions: | 6od3_H (3D-footprint 20231221) |
| Names: | bHLHb19, Class B basic helix-loop-helix protein 19, Immunoglobulin transcription factor 2, ITF-2, ITF2_HUMAN, SEF-2, SL3-3 enhancer factor 2, TCF-4, Transcription factor 4 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P15884 |
| Length: | 61 |
| Pfam Domains: | 2-55 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MRRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRE 60 61 R |
| Interface Residues: | 3, 6, 7, 9, 10, 11, 13, 14 |
| 3D-footprint Homologues: | 2ypa_A, 7z5k_B, 6od3_F, 2ql2_D, 7d8t_A, 2ypa_B, 2ql2_A, 6g1l_A |
| Binding Motifs: | 6od3_ABH CACGTG |
| Binding Sites: | 6od3_W / 6od3_X |
| Publications: | Yang J, Horton JR, Li J, Huang Y, Zhang X, Blumenthal RM, Cheng X. Structural basis for preferential binding of human TCF4 to DNA containing 5-carboxylcytosine. Nucleic Acids Res 47:8375-8387 (2019). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.