Transcription Factor

Accessions: 1sax_A (3D-footprint 20231221), 1sax_B (3D-footprint 20231221)
Names: MECI_STAAN, Methicillin resistance regulatory protein mecI
Organisms: Staphylococcus aureus, strain N315
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P68261
Length: 120
Pfam Domains: 6-62 MarR family
6-119 Penicillinase repressor
Sequence:
(in bold interface residues)
1 NKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKK 60
61 DNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNK 120
Interface Residues: 25, 41, 42, 44, 45, 46, 48, 49, 53, 65, 67
3D-footprint Homologues: 2p7c_B, 1sax_A, 1xsd_A
Binding Motifs: 1sax_A TGTAnTA
1sax_AB ATTACAnnTGTAnTA
Binding Sites: 1sax_C
1sax_D
Publications: García-Castellanos R, Mallorquí-Fernández G, Marrero A, Potempa J, Coll M, Gomis-Rüth F.X. On the transcriptional regulation of methicillin resistance: MecI repressor in complex with its operator. The Journal of biological chemistry 279:17888-96 (2004). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.