Transcription Factor
Accessions: | 1sax_A (3D-footprint 20231221), 1sax_B (3D-footprint 20231221) |
Names: | MECI_STAAN, Methicillin resistance regulatory protein mecI |
Organisms: | Staphylococcus aureus, strain N315 |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P68261 |
Length: | 120 |
Pfam Domains: | 6-62 MarR family 6-119 Penicillinase repressor |
Sequence: (in bold interface residues) | 1 NKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKK 60 61 DNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNK 120 |
Interface Residues: | 25, 41, 42, 44, 45, 46, 48, 49, 53, 65, 67 |
3D-footprint Homologues: | 2p7c_B, 1sax_A, 1xsd_A |
Binding Motifs: | 1sax_A TGTAnTA 1sax_AB ATTACAnnTGTAnTA |
Binding Sites: | 1sax_C 1sax_D |
Publications: | GarcÃa-Castellanos R, MallorquÃ-Fernández G, Marrero A, Potempa J, Coll M, Gomis-Rüth F.X. On the transcriptional regulation of methicillin resistance: MecI repressor in complex with its operator. The Journal of biological chemistry 279:17888-96 (2004). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.