Transcription Factor

Accessions: 1a3q_A (3D-footprint 20231221), 1a3q_B (3D-footprint 20231221)
Names: DNA-binding factor KBF2, H2TF1, Lymphocyte translocation chromosome 10 protein, Lyt10, NFKB2_HUMAN, NUCLEAR FACTOR KAPPA-B P52, Nuclear factor NF-kappa-B p100 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2, Oncogene Lyt-10
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q00653
Length: 285
Pfam Domains: 4-178 Rel homology domain (RHD)
Sequence:
(in bold interface residues)
1 GPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLV 60
61 THSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQR 120
121 QRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRSLPLKPVISQPIHDSKS 180
181 PGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVH 240
241 KQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYP
Interface Residues: 16, 18, 19, 21, 22, 24, 25, 26, 173, 179, 181, 210, 241
3D-footprint Homologues: 7cli_B, 1nfk_A, 1a3q_A, 2o61_A, 1gji_A, 2ram_A, 1imh_C
Binding Motifs: 1a3q_A GGGGaa
1a3q_AB GGGGATTCCCC
Binding Sites: 1a3q_C
1a3q_D
Publications: Cramer P, Larson C.J, Verdine G.L, Müller C.W. Structure of the human NF-kappaB p52 homodimer-DNA complex at 2.1 A resolution. The EMBO journal 16:7078-90 (1997). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.