Transcription Factor
| Accessions: | 2wty_A (3D-footprint 20250804) |
| Names: | Kreisler, Maf-B, MAFB_MOUSE, Segmentation protein Kr, Transcription factor Maf-1, TRANSCRIPTION FACTOR MAFB, V-maf musculoaponeurotic fibrosarcoma oncogene homolog B |
| Organisms: | Mus musculus |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P54841 |
| Length: | 94 |
| Pfam Domains: | 1-91 bZIP Maf transcription factor 27-87 bZIP transcription factor |
| Sequence: (in bold interface residues) | 1 SDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKT 60 61 QLIQQVEQLKQEVSRLARERDAYKVKSEKLANSG |
| Interface Residues: | 33, 37, 38, 40, 41, 42, 44, 45 |
| 3D-footprint Homologues: | 2wt7_B, 7x5e_E, 4eot_A, 7x5e_F, 5vpe_D, 6d6v_A |
| Binding Motifs: | 2wty_AB TGCnnACTnAGCA |
| Publications: | Pogenberg V, Consani Textor L, Vanhille L, Holton S.J, Sieweke M.H, Wilmanns M. Design of a bZip transcription factor with homo/heterodimer-induced DNA-binding preference. Structure (London, England : 1993) 22:466-77 (2014). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.