Transcription Factor

Accessions: 5zjq_A (3D-footprint 20241219)
Names: ABDB_DROME, Homeobox protein abdominal-B, IAB-7, Infraabdominal 7, P3, PH189
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P09087
Length: 63
Pfam Domains: 4-59 Homeobox domain
Sequence:
(in bold interface residues)
1 EWTKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKN 60
61 SQR
Interface Residues: 4, 5, 6, 44, 45, 47, 48, 51, 52, 54, 55, 56, 59
3D-footprint Homologues: 1zq3_P, 6m3d_C, 2lkx_A, 7q3o_C, 6es3_K, 2ld5_A, 8osb_E, 2hos_A, 8eml_B, 8pmf_A, 9b8u_A, 7psx_B, 2hdd_A, 8ejp_B, 4cyc_A, 8ik5_C, 7xrc_C, 2h8r_B, 8g87_X, 8bx1_A
Binding Motifs: 5zjq_A TTTATGA
5zjq_AB ATGATTTATGA
Binding Sites: 5zjq_C
5zjq_D
Publications: Zeiske T, Baburajendran N, Kaczynska A, Brasch J, Palmer AG 3rd, Shapiro L, Honig B, Mann RS. Intrinsic DNA Shape Accounts for Affinity Differences between Hox-Cofactor Binding Sites. Cell Rep 24:2221-2230 (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.