Transcription Factor

						

			
Accessions: 1gt0_C (3D-footprint 20231221)

			
Names: NF-A1, Oct-1, Octamer-binding protein 1, OCTAMER-BINDING TRANSCRIPTION FACTOR 1, OTF-1, PO2F1_HUMAN, POU domain, class 2, transcription factor 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P14859
Length: 137
Pfam Domains:      3-73 Pou domain - N-terminal to homeobox domain
   81-137 Homeobox domain
Sequence: 
(in bold interface residues)		   1 PSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSK   60
  61 LKPLLEKWLNDAENLGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNME  120
 121 KEVIRVWFSNRRQKEKR
Interface Residues: 25, 41, 42, 43, 44, 46, 47, 53, 57, 80, 81, 82, 83, 84, 85, 122, 123, 125, 126, 129, 130, 133, 134, 137
3D-footprint Homologues: 3d1n_M, 7u0g_M, 3l1p_A, 3q05_B, 7xzz_N, 2xsd_C, 8g87_X, 1o4x_A, 7xrc_C, 7xzx_N, 1e3o_C, 1au7_A, 3a01_E, 1fjl_B, 5zfz_A, 1ig7_A, 5zjt_E, 1puf_A, 6a8r_A, 3cmy_A, 1zq3_P, 2lkx_A, 6es3_K, 1nk2_P, 7q3o_C, 2r5y_A, 4xrs_G, 2hos_A, 1b72_A, 3rkq_B, 2d5v_B, 6m3d_C, 5hod_A, 2hdd_A, 2ld5_A, 5jlw_D, 1le8_A, 5flv_I, 1du0_A, 4cyc_A, 2h1k_B, 1jgg_B, 7psx_B, 3lnq_A, 4qtr_D
Binding Motifs: 1gt0_CD CTTTGTnnGGATGCTAAT
			
Publications: Reményi A, Lins K, Nissen L.J, Reinbold R, Schöler H.R, Wilmanns M. Crystal structure of a POU/HMG/DNA ternary complex suggests differential assembly of Oct4 and Sox2 on two enhancers. Genes & development 17:2048-59 (2003). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.