Transcription Factor
| Accessions: | 1hjc_D (3D-footprint 20260701) |
| Names: | Acute myeloid leukemia 1 protein, CBF-alpha-2, Core-binding factor subunit alpha-2, Oncogene AML-1, PEA2-alpha B, PEBP2-alpha B, Polyomavirus enhancer-binding protein 2 alpha B subunit, RUNT-RELATED TRANSCRIPTION FACTOR 1, RUNX1_MOUSE, SL3-3 enhancer factor 1 alpha B subunit, SL3/AKV core-binding factor alpha B subunit |
| Organisms: | Mus musculus |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q03347 |
| Length: | 118 |
| Pfam Domains: | 1-118 Runt domain |
| Sequence: (in bold interface residues) | 1 GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRN 60 61 ATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR |
| Interface Residues: | 21, 83, 111, 112, 115, 118 |
| 3D-footprint Homologues: | 4l18_E, 6vg8_D, 3wts_A, 6vgd_D, 4l0y_A |
| Binding Motifs: | 1hjc_D CaaCCACA |
| Binding Sites: | 1hjc_E 1hjc_F |
| Publications: | Tahirov T.H, Inoue-Bungo T, Morii H, Fujikawa A, Sasaki M, Kimura K, Shiina M, Sato K, Kumasaka T, Yamamoto M, Ishii S, Ogata K. Structural analyses of DNA recognition by the AML1/Runx-1 Runt domain and its allosteric control by CBFbeta. Cell 104:755-67 (2001). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.