Transcription Factor

Accessions: 1hjc_D (3D-footprint 20260701)
Names: Acute myeloid leukemia 1 protein, CBF-alpha-2, Core-binding factor subunit alpha-2, Oncogene AML-1, PEA2-alpha B, PEBP2-alpha B, Polyomavirus enhancer-binding protein 2 alpha B subunit, RUNT-RELATED TRANSCRIPTION FACTOR 1, RUNX1_MOUSE, SL3-3 enhancer factor 1 alpha B subunit, SL3/AKV core-binding factor alpha B subunit
Organisms: Mus musculus
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q03347
Length: 118
Pfam Domains: 1-118 Runt domain
Sequence:
(in bold interface residues)
1 GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRN 60
61 ATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
Interface Residues: 21, 83, 111, 112, 115, 118
3D-footprint Homologues: 4l18_E, 6vg8_D, 3wts_A, 6vgd_D, 4l0y_A
Binding Motifs: 1hjc_D CaaCCACA
Binding Sites: 1hjc_E
1hjc_F
Publications: Tahirov T.H, Inoue-Bungo T, Morii H, Fujikawa A, Sasaki M, Kimura K, Shiina M, Sato K, Kumasaka T, Yamamoto M, Ishii S, Ogata K. Structural analyses of DNA recognition by the AML1/Runx-1 Runt domain and its allosteric control by CBFbeta. Cell 104:755-67 (2001). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.