Transcription Factor

Accessions: 6e8c_A (3D-footprint 20250804)
Names: Double homeobox protein 10, Double homeobox protein 4, DUX4_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9UBX2
Length: 134
Pfam Domains: 5-58 Homeobox domain
25-57 Homeobox KN domain
79-133 Homeobox domain
102-132 Homeobox KN domain
Sequence:
(in bold interface residues)
1 RGRGRRRRLVWTPSQSEALRAFERNPYPGIATRERLAQAIGIPEPRVQIWFQNERSRQLR 60
61 QHRRESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPES 120
121 RIQIWFQNRRARHP
Interface Residues: 5, 8, 33, 45, 46, 48, 49, 52, 53, 56, 57, 67, 73, 79, 80, 81, 82, 120, 121, 123, 124, 127, 128, 130, 131, 132
3D-footprint Homologues: 5zfz_A, 3d1n_M, 1au7_A, 1qpi_A, 8bx1_A, 4xrm_B, 8g87_X, 6m3d_C, 3a01_E, 1ig7_A, 1puf_A, 8ejp_B, 6a8r_A, 8pmf_A, 1fjl_B, 3cmy_A, 2lkx_A, 1jgg_B, 3lnq_A, 1nk2_P, 1zq3_P, 2ld5_A, 4cyc_A, 8ik5_C, 5flv_I, 2hdd_A, 5zjt_E, 2r5y_A, 1puf_B, 8osb_E, 7psx_B, 5hod_A, 2hos_A, 8eml_B, 7q3o_C, 5jlw_D, 3rkq_B, 1b72_A, 6es3_K, 4xrs_G, 9b8u_A, 1e3o_C, 1le8_A, 1du0_A, 4qtr_D
Binding Motifs: 6e8c_A TTGATnAnATTAC
Binding Sites: 6e8c_B
6e8c_C
Publications: Lee JK, Bosnakovski D, Toso EA, Dinh T, Banerjee S, Bohl TE, Shi K, Orellana K, Kyba M, Aihara H. Crystal Structure of the Double Homeodomain of DUX4 in Complex with DNA. Cell Rep 25:2955-2962 (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.