Transcription Factor
| Accessions: | POU1F1_DBD (HumanTF 1.0), POU1F1 (HT-SELEX2 May2017) |
| Names: | GHF-1, Growth hormone factor 1, PIT-1, PIT1_HUMAN, Pituitary-specific positive transcription factor 1, POU1F1, ENSG00000064835 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | P28069 |
| Notes: | Ensembl ID: ENSG00000064835; DNA-binding domain sequence; TF family: homeodomain+POU; Clone source: Gene synthesis, TF family: POU experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: POU experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3 |
| Length: | 188 |
| Pfam Domains: | 22-95 Pou domain - N-terminal to homeobox domain 112-168 Homeobox domain |
| Sequence: (in bold interface residues) | 1 AADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGS 60 61 EFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISI 120 121 AAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSI 180 181 SKEHLECR |
| Interface Residues: | 47, 63, 64, 65, 66, 68, 69, 71, 72, 75, 79, 112, 113, 114, 115, 153, 154, 156, 157, 160, 161, 164, 165, 168 |
| 3D-footprint Homologues: | 3l1p_A, 7u0g_M, 3d1n_M, 2xsd_C, 1o4x_A, 1e3o_C, 7xrc_C, 1au7_A, 8g87_X, 2d5v_B, 1ig7_A, 6a8r_A, 3cmy_A, 5zfz_A, 1fjl_B, 2lkx_A, 1zq3_P, 1nk2_P, 2ld5_A, 1b72_A, 5zjt_E, 5hod_A, 2h1k_B, 1jgg_B, 3lnq_A, 4xrs_G, 2hdd_A, 3rkq_B, 2r5y_A, 7psx_B, 5flv_I, 2hos_A, 5jlw_D, 7q3o_C, 1le8_A, 4cyc_A, 1du0_A, 4qtr_D, 3a01_E, 1puf_A, 6es3_K |
| Binding Motifs: | POU1F1_DBD_1 ctyaTGmATAwttaAtk POU1F1_DBD_2 awTATGCwAATkAg POU1F1_4 dTAATgAkATGCry POU1F1_5 wTATGCwAATkAgs POU1F1_6 wTAATTTATKCrt POU1F1_methyl_1 wTAATGAkATGCry POU1F1_methyl_2 wTATGCwAATkAGs POU1F1_methyl_3 wTAATTTATkCGy |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.