Transcription Factor

Accessions: CREB3L4 (HT-SELEX2 May2017)
Names: CREB3L4, ENSG00000143578
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 142
Pfam Domains: 61-119 bZIP transcription factor
65-114 Basic region leucine zipper
Sequence:
(in bold interface residues)
1 VSELPFDAHAHILPRAGTVAPVPCTTLLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAE 60
61 ERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQNQELQKKVQELERHNISLV 120
121 AQLRQLQTLIAQTSNKAAQTST
Interface Residues: 69, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83
3D-footprint Homologues: 7x5e_F, 1gd2_G, 6mg1_B, 5t01_B, 1dh3_C, 5vpe_D, 8osl_P, 4h10_A
Binding Motifs: CREB3L4_4 ygCCACGTCAyc
CREB3L4_5 grTGACGTCAyc
CREB3L4_6 cgmcACGTgkcm
CREB3L4_methyl_1 yGCCACrTCAyc
CREB3L4_methyl_2 grTGAyGTCAyc
CREB3L4_methyl_3 yGMCACGTgkCm
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.