Transcription Factor

Accessions: 1dsz_B (3D-footprint 20241219)
Names: Nuclear receptor subfamily 2 group B member 1, RETINOIC ACID RECEPTOR RXR-ALPHA, Retinoid X receptor alpha, RXRA_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P19793
Length: 84
Pfam Domains: 7-75 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 GSFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRC 60
61 QYCRYQKCLAMGMKREAVQEERQR
Interface Residues: 17, 19, 26, 29, 30, 33, 34, 58, 80, 82, 84
3D-footprint Homologues: 7wnh_D, 6l6q_B, 3g9m_B, 7xvn_C, 2han_B, 8cef_H, 2a66_A, 2nll_B, 8hbm_B, 2ff0_A, 7xv6_B, 2han_A, 7prw_B, 5cbx_B, 5cbz_E, 3g6t_A, 8rm6_A
Binding Motifs: 1dsz_AB tGACCnnTGaCC
Binding Sites: 1dsz_C
1dsz_D
Publications: Rastinejad F., Wagner T., Zhao Q., Khorasanizadeh S. Structure of the RXR-RAR DNA-binding complex on the retinoic acid response element DR1.. EMBO J. 19:1045-1054 (2000). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.