Transcription Factor

						

			
Accessions: 4wk8_F (3D-footprint 20231221), 4wk8_G (3D-footprint 20231221)

			
Names: Forkhead box protein P3, FOXP3_HUMAN, Scurfin
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9BZS1
Length: 80
Pfam Domains:      1-75 Fork head domain
Sequence: 
(in bold interface residues)		   1 RPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFV   60
  61 RVESEKGAVWTVDELEFRKK
Interface Residues: 41, 44, 46, 47, 48, 50, 51, 52, 54, 55, 64, 66
3D-footprint Homologues: 3l2c_A, 7vox_H, 2hdc_A, 7yze_A, 7cby_C, 3co6_C, 6ako_C, 2c6y_A, 7yzg_A, 7tdw_A, 3g73_A, 7yz7_A, 6el8_A, 7tdx_A, 7yzb_A, 6nce_A, 2uzk_A, 7vou_C, 2a07_J, 3qrf_G
Binding Motifs: 4wk8_FG ATTTG
Binding Sites: 4wk8_B
4wk8_A
			
Publications: Chen Y, Chen C, Zhang Z, Liu C.C, Johnson M.E, Espinoza C.A, Edsall L.E, Ren B, Zhou X.J, Grant S.F, Wells A.D, Chen L. DNA binding by FOXP3 domain-swapped dimer suggests mechanisms of long-range chromosomal interactions. Nucleic acids research 43:1268-82 (2015). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.