Transcription Factor

Accessions: 4wk8_F (3D-footprint 20250804), 4wk8_G (3D-footprint 20250804)
Names: Forkhead box protein P3, FOXP3_HUMAN, Scurfin
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9BZS1
Length: 80
Pfam Domains: 1-75 Fork head domain
Sequence:
(in bold interface residues)
1 RPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFV 60
61 RVESEKGAVWTVDELEFRKK
Interface Residues: 24, 33, 35, 41, 43, 44, 46, 47, 48, 50, 51, 52, 54, 55, 64, 66
3D-footprint Homologues: 8vfz_O, 7kt2_A, 3l2c_A, 8bzm_E, 7vox_H, 2hdc_A, 7yze_A, 3g73_A, 6el8_A, 7yzg_A, 7tdw_A, 7yz7_A, 6nce_A, 2uzk_A, 7tdx_A, 2a07_J, 7yzb_A, 7cby_C, 3co6_C, 7vou_C, 6ako_C, 2c6y_A, 3qrf_G, 8sro_B
Binding Motifs: 4wk8_FG ATTTG
Binding Sites: 4wk8_B
4wk8_A
Publications: Chen Y, Chen C, Zhang Z, Liu C.C, Johnson M.E, Espinoza C.A, Edsall L.E, Ren B, Zhou X.J, Grant S.F, Wells A.D, Chen L. DNA binding by FOXP3 domain-swapped dimer suggests mechanisms of long-range chromosomal interactions. Nucleic acids research 43:1268-82 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.