Transcription Factor
| Accessions: | 3g6t_B (3D-footprint 20250804) |
| Names: | GCR_RAT, Glucocorticoid receptor, GR, Nuclear receptor subfamily 3 group C member 1 |
| Organisms: | Rattus norvegicus |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P06536 |
| Length: | 72 |
| Pfam Domains: | 2-70 Zinc finger, C4 type (two domains) |
| Sequence: (in bold interface residues) | 1 HMCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPACR 60 61 YRKCLQAGMNLE |
| Interface Residues: | 11, 12, 14, 15, 21, 22, 24, 25, 28, 29, 54 |
| 3D-footprint Homologues: | 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 7xvn_C, 4iqr_B, 2han_A, 1hcq_E, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 8hbm_B, 2nll_B, 1lat_A, 7xv6_B, 4hn5_B, 8rm6_A, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A |
| Binding Motifs: | 3g6t_AB GnACAnnnTGT 3g6t_B TGTnCT |
| Binding Sites: | 3g6t_C 3g6t_D |
| Publications: | Meijsing S.H, Pufall M.A, So A.Y, Bates D.L, Chen L, Yamamoto K.R. DNA binding site sequence directs glucocorticoid receptor structure and activity. Science (New York, N.Y.) 324:407-10 (2009). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.