Transcription Factor

Accessions: 5wc9_E (3D-footprint 20231221)
Names: GHF-1, Growth hormone factor 1, PIT-1, PIT1_HUMAN, Pituitary-specific positive transcription factor 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P28069
Length: 132
Pfam Domains: 3-73 Pou domain - N-terminal to homeobox domain
75-130 Homeobox domain
Sequence:
(in bold interface residues)
1 SPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACK 60
61 LKAILSKWLEEAEQKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVW 120
121 FCNRRQREKRVK
Interface Residues: 25, 41, 42, 43, 44, 46, 47, 49, 50, 53, 57, 74, 75, 77, 115, 116, 118, 119, 122, 123, 126, 127, 130
3D-footprint Homologues: 3l1p_A, 7u0g_M, 3d1n_M, 1o4x_A, 8g87_X, 1e3o_C, 1au7_A, 7xrc_C, 2xsd_C, 2d5v_B, 6a8r_A, 3cmy_A, 5zfz_A, 1fjl_B, 2lkx_A, 6m3d_C, 1nk2_P, 1ig7_A, 7psx_B, 5hod_A, 2h1k_B, 1jgg_B, 3lnq_A, 4xrs_G, 2hdd_A, 3rkq_B, 2r5y_A, 5flv_I, 2hos_A, 1b72_A, 5zjt_E, 2ld5_A, 5jlw_D, 7q3o_C, 1le8_A, 1du0_A, 4qtr_D, 3a01_E, 1puf_A, 6es3_K, 1zq3_P, 4cyc_A
Binding Motifs: 5wc9_E CATTCAT
5wc9_EF TTCATTCATTCAT
Binding Sites: 5wc9_G
5wc9_H
Publications: Agarwal S, Cho TY. Biochemical and structural characterization of a novel cooperative binding mode by Pit-1 with CATT repeats in the macrophage migration inhibitory factor promoter. Nucleic Acids Res : (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.