Transcription Factor
| Accessions: | 1jfs_A (3D-footprint 20250804) |
| Names: | HTH-type transcriptional repressor PurR, Pur regulon repressor, PURINE NUCLEOTIDE SYNTHESIS REPRESSOR, PURR_ECOLI |
| Organisms: | Escherichia coli, strain K12 |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P0ACP7 |
| Length: | 339 |
| Pfam Domains: | 2-47 Bacterial regulatory proteins, lacI family 59-324 Periplasmic binding proteins and sugar binding domain of LacI family 61-307 Periplasmic binding protein domain 170-330 Periplasmic binding protein-like domain |
| Sequence: (in bold interface residues) | 1 ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKS 60 61 IGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLV 120 121 MCSEYPEPLLAMLEEYRHIPMVVMDFGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREI 180 181 GVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPT 240 241 AVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETA 300 301 FNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR |
| Interface Residues: | 3, 4, 13, 14, 15, 16, 18, 19, 25, 26, 27, 50, 53, 54 |
| 3D-footprint Homologues: | 7ce1_D, 1efa_B, 3oqm_C, 1l1m_B, 1jft_A, 1zvv_A |
| Binding Motifs: | 1jfs_A CGcanACg |
| Binding Sites: | 1jfs_B |
| Publications: | Huffman J.L, Lu F, Zalkin H, Brennan R.G. Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor. Biochemistry 41:511-20 (2002). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.