Transcription Factor
| Accessions: | 4eot_A (3D-footprint 20260701) |
| Names: | MAFA_HUMAN, Pancreatic beta-cell-specific transcriptional activator, RIPE3b1 factor, Transcription factor MafA, V-maf musculoaponeurotic fibrosarcoma oncogene homolog A |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q8NHW3 |
| Length: | 92 |
| Pfam Domains: | 1-92 bZIP Maf transcription factor |
| Sequence: (in bold interface residues) | 1 RFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESE 60 61 KCQLQSQVEQLKLEVGRLAKERDLYKEKYEKL |
| Interface Residues: | 35, 39, 42, 43, 46, 47 |
| 3D-footprint Homologues: | 7x5e_E, 7x5e_F, 2wt7_B, 4eot_A, 2wt7_A |
| Binding Motifs: | 4eot_A TGCtgaGT 4eot_AB tGCnnACTnnGCa |
| Binding Sites: | 4eot_C 4eot_D |
| Publications: | Lu X, Guanga G.P, Wan C, Rose R.B. A Novel DNA Binding Mechanism for maf Basic Region-Leucine Zipper Factors Inferred from a MafA-DNA Complex Structure and Binding Specificities. Biochemistry : (2012). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.