Transcription Factor

Accessions: 2h8r_B (3D-footprint 20250804)
Names: Hepatocyte nuclear factor 1-beta, HNF-1-beta, HNF-1B, HNF1B_HUMAN, Homeoprotein LFB3, TCF-2, Transcription factor 2, Variant hepatic nuclear factor 1, vHNF1
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P35680
Length: 176
Pfam Domains: 2-93 Hepatocyte nuclear factor 1 (HNF-1), N terminus
98-171 Homeobox domain
Sequence:
(in bold interface residues)
1 SILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSH 60
61 LSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQMRRNRFKWGPASQQILYQAYDRQK 120
121 NPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEAFR
Interface Residues: 57, 58, 59, 60, 62, 63, 69, 70, 79, 98, 101, 161, 162, 163, 164, 167, 168, 171
3D-footprint Homologues: 4on0_B, 2h8r_B, 8pi8_B, 1fjl_B, 5zfz_A, 4j19_B, 1le8_A
Binding Motifs: 2h8r_AB tGGTGAATtATTAAC
2h8r_B TAATnntTcACCa
Binding Sites: 2h8r_E
2h8r_F
Publications: Lu P, Rha G.B, Chi Y.I. Structural basis of disease-causing mutations in hepatocyte nuclear factor 1beta. Biochemistry 46:12071-80 (2007). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.