Transcription Factor

Accessions: 2a07_J (3D-footprint 20241219), 2a07_K (3D-footprint 20241219), 2as5_F (3D-footprint 20241219), 2as5_G (3D-footprint 20241219)
Names: CAG repeat protein 44, Forkhead box protein P2, FOXP2_HUMAN, Trinucleotide repeat-containing gene 10 protein
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O15409
Length: 83
Pfam Domains: 3-80 Fork head domain
Sequence:
(in bold interface residues)
1 IVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKC 60
61 FVRVENVKGAVWTVDEVEYQKRR
Interface Residues: 26, 45, 46, 48, 49, 50, 52, 53, 54, 56, 57, 68
3D-footprint Homologues: 8vfz_O, 8bzm_E, 7vox_H, 2hdc_A, 7yzb_A, 6el8_A, 7vou_C, 2c6y_A, 7yze_A, 7cby_C, 7yzg_A, 7tdw_A, 7yz7_A, 3g73_A, 7tdx_A, 2a07_J, 8sro_B
Binding Motifs: 2a07_FJ ACAAA
2a07_IK tTTGTT
2a07_J TTTg
2as5_FN GGArnannTGnTT
2as5_GM aAnCannnnnTCC
Binding Sites: 2a07_A / 2a07_C
2a07_B / 2a07_D
Publications: Stroud J.C, Wu Y, Bates D.L, Han A, Nowick K, Paabo S, Tong H, Chen L. Structure of the forkhead domain of FOXP2 bound to DNA. Structure (London, England : 1993) 14:159-66 (2006). [Pubmed]

Wu Y, Borde M, Heissmeyer V, Feuerer M, Lapan A.D, Stroud J.C, Bates D.L, Guo L, Han A, Ziegler S.F, Mathis D, Benoist C, Chen L, Rao A. FOXP3 controls regulatory T cell function through cooperation with NFAT. Cell 126:375-87 (2006). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.