Transcription Factor
| Accessions: | 2a07_J (3D-footprint 20260701), 2a07_K (3D-footprint 20260701), 2as5_F (3D-footprint 20260701), 2as5_G (3D-footprint 20260701) |
| Names: | CAG repeat protein 44, Forkhead box protein P2, FOXP2_HUMAN, Trinucleotide repeat-containing gene 10 protein |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | O15409 |
| Length: | 83 |
| Pfam Domains: | 3-80 Fork head domain |
| Sequence: (in bold interface residues) | 1 IVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKC 60 61 FVRVENVKGAVWTVDEVEYQKRR |
| Interface Residues: | 26, 43, 45, 46, 48, 49, 50, 52, 53, 54, 56, 57, 68 |
| 3D-footprint Homologues: | 8vfz_O, 3l2c_A, 8bzm_E, 7vox_H, 2hdc_A, 2c6y_A, 7yzg_A, 7tdw_A, 3g73_A, 7yz7_A, 6el8_A, 7tdx_A, 7yzb_A, 6nce_A, 2uzk_A, 7vou_C, 2a07_J, 7yze_A, 7cby_C, 3co6_C, 6ako_C, 8sro_B, 3qrf_G |
| Binding Motifs: | 2a07_FJ ACAAA 2a07_IK tTTGTT 2a07_J TTTg 2as5_FN GGArnannTGnTT 2as5_GM aAnCannnnnTCC |
| Binding Sites: | 2a07_A / 2a07_C 2a07_B / 2a07_D |
| Publications: | Stroud J.C, Wu Y, Bates D.L, Han A, Nowick K, Paabo S, Tong H, Chen L. Structure of the forkhead domain of FOXP2 bound to DNA. Structure (London, England : 1993) 14:159-66 (2006). [Pubmed] Wu Y, Borde M, Heissmeyer V, Feuerer M, Lapan A.D, Stroud J.C, Bates D.L, Guo L, Han A, Ziegler S.F, Mathis D, Benoist C, Chen L, Rao A. FOXP3 controls regulatory T cell function through cooperation with NFAT. Cell 126:375-87 (2006). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.