Transcription Factor

Accessions: 1zs4_C (3D-footprint 20231221)
Names: Regulatory protein CII, RPC2_LAMBD
Organisms: Enterobacteria phage lambda, Escherichia phage lambda
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P03042
Length: 79
Pfam Domains: 1-79 Bacteriophage CII protein
Sequence:
(in bold interface residues)
1 ANKRNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKRDWIPKFSMLLAVLEWGVV 60
61 DDDMARLARQVAAILTNKK
Interface Residues: 23, 24, 33, 34, 35, 36, 38, 39
3D-footprint Homologues: 8igr_C
Binding Motifs: 1zs4_ACD GTTGCgnnnnTTTGCa
Publications: Jain D, Kim Y, Maxwell K.L, Beasley S, Zhang R, Gussin G.N, Edwards A.M, Darst S.A. Crystal structure of bacteriophage lambda cII and its DNA complex. Molecular cell 19:259-69 (2005). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.