Transcription Factor

Accessions: 5d8c_A (3D-footprint 20241219), 5e01_A (3D-footprint 20241219)
Names: MerR family regulator protein, Y186_HAEIN, Uncharacterized HTH-type transcriptional regulator HI_0186
Organisms: Haemophilus influenzae, strain ATCC 51907 / DSM 11121 / KW20 / Rd
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P44558
Length: 126
Pfam Domains: 3-68 MerR HTH family regulatory protein
4-41 MerR family regulatory protein
47-107 MerR, DNA binding
Sequence:
(in bold interface residues)
1 MTYTTAKAAEKIGISAYTLRFYDKEGLLPNVGRDEYGNRRFTDKDLQWLSLLQCLKNTGM 60
61 SLKDIKRFAECTIIGDDTIEERLSLFENQTKNVKCQIAELKRYLDLLEYKLAFYQKAKAL 120
121 GSVKAV
Interface Residues: 17, 20, 21, 24, 25, 38, 39
3D-footprint Homologues: 6ldi_G, 7tea_B, 6xh7_H, 7tec_A, 1r8e_A, 6xl5_H, 5c8e_C, 7ckq_G
Binding Motifs: 5d8c_A CTCTnA
5d8c_AB AGAGnnnnCTCT
5e01_A CTCTnA
5e01_AB AGAGnnnnCTCT
Binding Sites: 5d8c_C
5d8c_D
5e01_C / 5e01_D
Publications: Couñago RM, Chen NH, Chang CW, Djoko KY, McEwan AG, Kobe B. Structural basis of thiol-based regulation of formaldehyde detoxification in H. influenzae by a MerR regulator with no sensor region 44:6981-93 (Nucleic). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.