Transcription Factor

Accessions: 4qtr_C (3D-footprint 20260701)
Names: dualENH
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 57
Pfam Domains: 1-54 Homeobox domain
Sequence:
(in bold interface residues)
1 RTAFSEEQKKALDLAFYFDRYLTPEWRRYLSQRLGLNEAQIKIWFQNKRAKIKKSTG
Interface Residues: 1, 39, 40, 42, 43, 46, 47, 49, 50, 51, 54
3D-footprint Homologues: 1au7_A, 5zjt_E, 4cyc_A, 2r5y_A, 1puf_B, 8ik5_C, 1fjl_B, 7psx_B, 5hod_A, 3d1n_M, 2hos_A, 1nk2_P, 8ejp_B, 1b72_A, 6a8r_A, 8osb_E, 1ig7_A, 7q3o_C, 5jlw_D, 3lnq_A, 2ld5_A, 8eml_B, 6es3_K, 4xrs_G, 3a01_E, 2d5v_B, 8pmf_A, 1jgg_B, 5zfz_A, 3rkq_B, 2lkx_A, 1puf_A, 6m3d_C, 5flv_I, 3cmy_A, 2hdd_A, 9b8u_A, 1le8_A, 2xsd_C, 7xrc_C, 1e3o_C, 8bx1_A, 4qtr_D, 1zq3_P, 1o4x_A, 1du0_A, 8g87_X
Binding Motifs: 4qtr_CD aAnnnnnTt
Publications: Mou Y, Yu JY, Wannier TM, Guo CL, Mayo SL. Computational design of co-assembling protein-DNA nanowires. Nature 525:230-3 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.