Transcription Factor

Accessions: Q8IUE0 (JASPAR 2024)
Names: Homeobox protein TGIF2LY, TF2LY_HUMAN, TGF-beta-induced transcription factor 2-like protein, TGFB-induced factor 2-like protein, Y-linked, TGIF-like on the Y
Organisms: Homo sapiens
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q8IUE0
Length: 185
Pfam Domains: 68-107 Homeobox KN domain
74-107 Homeobox domain
Sequence:
(in bold interface residues)
1 MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAE 60
61 SVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLRISNWFINARRRILPDMLQQRRNDP 120
121 IIGHKTGKDAHATHLQSTEASVPAKSGPVVQTMYKACPCGPCQRARCQERSNQIRSRPLA 180
181 RSSPE
Interface Residues: 51, 53, 54, 55, 56, 98, 99, 102, 103, 104, 106, 107
3D-footprint Homologues: 6fqp_B, 1puf_B, 1k61_B, 8osb_E, 1le8_A, 1le8_B, 4xrm_B, 1fjl_B, 1mnm_C, 6fqq_E, 2d5v_B
Binding Motifs: MA1572.1 TGACAgcTGTCA
Publications: Bertolino E., Reimund B., Wildt-Perinic D., Clerc R. G. A novel homeobox protein which recognizes a TGT core and functionally interferes with a retinoid-responsive motif. J. Biol. Chem. 270:31178-31188 (1995). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.