Transcription Factor

						

			
Accessions: 4r2e_A (3D-footprint 20231221), 5kl2_A (3D-footprint 20231221)

			
Names: Wilms tumor protein, isoform 4/CRA_a, WT1_HUMAN, WT33, Wilms tumor protein
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P19544
Length: 88
Pfam Domains:      4-28 C2H2-type zinc finger
     4-28 Zinc finger, C2H2 type
    21-45 Zinc-finger double domain
    34-56 C2H2-type zinc finger
    34-56 Zinc finger, C2H2 type
    34-54 Zinc-finger of C2H2 type
    48-74 Zinc-finger double domain
    62-84 C2H2-type zinc finger
    62-86 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 EKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEK   60
  61 PFSCRWPSCQKKFARSDELVRHHNMHQR
Interface Residues: 16, 17, 18, 19, 20, 22, 23, 44, 45, 46, 47, 48, 50, 51, 52, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82
3D-footprint Homologues: 6jnm_A, 8cuc_F, 1tf3_A, 7y3l_A, 6ml4_A, 7n5w_A, 5ei9_F, 2jpa_A, 8ssq_A, 1mey_C, 7w1m_H, 5und_A, 2drp_D, 1f2i_J, 7eyi_G, 5k5i_A, 2kmk_A, 8ssu_A, 2gli_A, 1g2f_F, 6blw_A, 5kkq_D, 1tf6_A, 6u9q_A, 4x9j_A, 2i13_A, 5kl3_A, 2wbs_A, 1ubd_C, 7ysf_A, 5v3j_F, 8h9h_G, 6wmi_A, 2lt7_A, 7y3m_I, 6e94_A, 6a57_A, 8gn3_A, 3uk3_C, 5yj3_D, 5yel_A, 1llm_D, 7txc_E, 4m9v_C
Binding Motifs: 4r2e_A GCGTGGGcGG
5kl2_A aCTCCCACGC
Binding Sites: 4r2e_C
5kl2_B
5kl2_C
4r2e_B
			
Publications: Hashimoto H, Olanrewaju Y.O, Zheng Y, Wilson G.G, Zhang X, Cheng X. Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence. Genes & development 28:2304-13 (2014). [Pubmed]


Hashimoto H, Zhang X, Zheng Y, Wilson GG, Cheng X. Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications. Nucleic Acids Res 44:10165-10176 (2016). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.