Transcription Factor
| Accessions: | 5hlh_F (3D-footprint 20250804), 5hlh_H (3D-footprint 20250804) |
| Names: | MarR family transcriptional regulator, Q5HKZ1_STAEQ |
| Organisms: | Staphylococcus epidermidis, strain ATCC 35984 / RP62A |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q5HKZ1 |
| Length: | 136 |
| Pfam Domains: | 30-87 Sugar-specific transcriptional regulator TrmB 34-92 MarR family 35-101 Winged helix DNA-binding domain 35-92 MarR family 40-108 HxlR-like helix-turn-helix 48-89 FeoC like transcriptional regulator 58-104 Transcriptional regulator PadR-like family |
| Sequence: (in bold interface residues) | 1 MKQEQMRLANQLFSAYNVSRLFAQFYEKKLKQFGITYSQYLVLLTLWEENPQTLNSIGRH 60 61 LDLSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITLTDNGQQQQEAVFEAISSCLYDET 120 121 KYVFEELEQTLKHLIE |
| Interface Residues: | 55, 64, 65, 66, 67, 69, 70, 71, 73, 74, 91 |
| 3D-footprint Homologues: | 7el3_B, 7dvv_A, 5yi2_J, 5h3r_A, 1z9c_A, 6c2s_C, 3q5f_A, 6jbx_A, 4lln_I, 3zpl_B, 5f7q_C, 4aik_A, 4fx4_B, 5hlg_E, 5hso_A |
| Binding Motifs: | 5hlh_FH CGATTnAGnnnnCTnAATCG |
| Binding Sites: | 5hlh_M / 5hlh_N |
| Publications: | Liu G, Liu X, Xu H, Liu X, Zhou H, Huang Z, Gan J, Chen H, Lan L, Yang CG. Structural Insights into the Redox-Sensing Mechanism of MarR-Type Regulator AbfR. J Am Chem Soc 139:1598-1608 (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.