Transcription Factor
| Accessions: | 6fas_B (3D-footprint 20260701) |
| Names: | B3 domain-containing transcription repressor VAL1, Protein HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE 2, Protein VP1/ABI3-LIKE 1, VAL1_ARATH |
| Organisms: | Arabidopsis thaliana |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Length: | 109 |
| Pfam Domains: | 9-106 B3 DNA binding domain |
| Sequence: (in bold interface residues) | 1 MNLNIVPLFEKTLSASDAGRIGRLVLPKAAEAYFPPISQSEGIPLKIQDVRGREWTFQFR 60 61 YWPNNNSRMYVLEGVTPCIQSMMLQAGDTVTFSRVDPGGKLIMGSRKAA |
| Interface Residues: | 14, 16, 21, 22, 23, 25, 60, 62, 63, 64, 65, 66, 67, 68, 69 |
| 3D-footprint Homologues: | 6j9b_A, 6j9c_D, 7et6_A, 6fas_B, 8oj2_A |
| Binding Motifs: | 6fas_B CATgC |
| Binding Sites: | 6fas_E 6fas_F |
| Publications: | Sasnauskas G, Kauneckaite K, Siksnys V. Structural basis of DNA target recognition by the B3 domain of Arabidopsis epigenome reader VAL1. Nucleic Acids Res 46:4316-4324 (2018). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.