Transcription Factor

Accessions: 6fas_B (3D-footprint 20260701)
Names: B3 domain-containing transcription repressor VAL1, Protein HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE 2, Protein VP1/ABI3-LIKE 1, VAL1_ARATH
Organisms: Arabidopsis thaliana
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 109
Pfam Domains: 9-106 B3 DNA binding domain
Sequence:
(in bold interface residues)
1 MNLNIVPLFEKTLSASDAGRIGRLVLPKAAEAYFPPISQSEGIPLKIQDVRGREWTFQFR 60
61 YWPNNNSRMYVLEGVTPCIQSMMLQAGDTVTFSRVDPGGKLIMGSRKAA
Interface Residues: 14, 16, 21, 22, 23, 25, 60, 62, 63, 64, 65, 66, 67, 68, 69
3D-footprint Homologues: 6j9b_A, 6j9c_D, 7et6_A, 6fas_B, 8oj2_A
Binding Motifs: 6fas_B CATgC
Binding Sites: 6fas_E
6fas_F
Publications: Sasnauskas G, Kauneckaite K, Siksnys V. Structural basis of DNA target recognition by the B3 domain of Arabidopsis epigenome reader VAL1. Nucleic Acids Res 46:4316-4324 (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.