Transcription Factor

Accessions: sob (FlyZincFinger 1.0 )
Names: CG3242
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 144
Pfam Domains: 7-29 C2H2-type zinc finger
7-27 Zinc-finger of C2H2 type
7-24 C2H2-type zinc finger
7-29 Zinc finger, C2H2 type
21-45 Zinc-finger double domain
35-57 C2H2-type zinc finger
35-55 C2H2-type zinc finger
35-57 Zinc finger, C2H2 type
49-72 Zinc-finger double domain
63-85 Zinc finger, C2H2 type
63-86 C2H2-type zinc finger
79-101 Zinc-finger double domain
90-109 C2H2-type zinc finger
91-113 Zinc finger, C2H2 type
91-113 C2H2-type zinc finger
92-110 Zinc-finger of C2H2 type
105-129 Zinc-finger double domain
119-129 C2H2-type zinc finger
119-141 Zinc finger, C2H2 type
119-142 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 QRSKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKE 60
61 KPFKCAECGKGFCQSRTLAVHKILHMEESPHKCPVCNRSFNQRSNLKTHLLTHTDIKPYN 120
121 CASCGKVFRRNCDLRRHSLTHNLS
Interface Residues: 17, 18, 19, 20, 21, 23, 24, 25, 26, 27, 30, 35, 45, 46, 47, 48, 49, 50, 51, 52, 53, 56, 73, 74, 75, 76, 77, 79, 80, 82, 83, 88, 101, 102, 103, 104, 105, 106, 107, 108, 112, 122, 126, 128, 129, 130, 131, 132, 133, 135, 136
3D-footprint Homologues: 3uk3_C, 8cuc_F, 7y3l_A, 7n5w_A, 5v3j_F, 1f2i_J, 7w1m_H, 6blw_A, 1tf6_A, 5yel_A, 8ssq_A, 2gli_A, 1g2f_F, 5kkq_D, 4x9j_A, 8ssu_A, 1llm_D, 5kl3_A, 5ei9_F, 6ml4_A, 8h9h_G, 4m9v_C, 6e94_A, 8gh6_A, 7y3m_I, 7ysf_A, 2jpa_A, 1ubd_C, 2kmk_A, 1tf3_A, 5k5i_A, 6u9q_A, 2wbs_A, 2lt7_A, 6jnm_A, 6a57_A, 1yuj_A, 2drp_D, 8gn3_A, 7txc_E, 3oym_A, 1dp7_P, 5yj3_D
Binding Motifs: sob_SANGER_10_FBgn0004892 GCTWCTGkkktwv
sob_SOLEXA_5_FBgn0004892 bkGCTACyGkkykk
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.