Transcription Factor
| Accessions: | sob (FlyZincFinger 1.0 ) |
| Names: | CG3242 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 144 |
| Pfam Domains: | 7-27 Zinc-finger of C2H2 type 7-24 C2H2-type zinc finger 7-29 Zinc finger, C2H2 type 7-29 C2H2-type zinc finger 21-45 Zinc-finger double domain 35-57 C2H2-type zinc finger 35-55 C2H2-type zinc finger 35-57 Zinc finger, C2H2 type 49-72 Zinc-finger double domain 63-86 C2H2-type zinc finger 63-85 Zinc finger, C2H2 type 79-101 Zinc-finger double domain 90-109 C2H2-type zinc finger 91-113 C2H2-type zinc finger 91-113 Zinc finger, C2H2 type 92-110 Zinc-finger of C2H2 type 105-129 Zinc-finger double domain 119-141 Zinc finger, C2H2 type 119-142 C2H2-type zinc finger 119-129 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 QRSKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKE 60 61 KPFKCAECGKGFCQSRTLAVHKILHMEESPHKCPVCNRSFNQRSNLKTHLLTHTDIKPYN 120 121 CASCGKVFRRNCDLRRHSLTHNLS |
| Interface Residues: | 17, 18, 19, 20, 21, 23, 24, 25, 26, 27, 30, 35, 45, 46, 47, 48, 49, 50, 51, 52, 53, 56, 73, 74, 75, 76, 77, 79, 80, 82, 83, 88, 101, 102, 103, 104, 105, 106, 107, 108, 112, 122, 126, 128, 129, 130, 131, 132, 133, 135, 136 |
| 3D-footprint Homologues: | 7y3l_A, 7n5w_A, 5v3j_F, 3uk3_C, 8cuc_F, 5yel_A, 2gli_A, 8ssq_A, 1g2f_F, 5kkq_D, 4x9j_A, 8ssu_A, 1llm_D, 5kl3_A, 5ei9_F, 6ml4_A, 1f2i_J, 7w1m_H, 6blw_A, 1tf6_A, 4m9v_C, 8h9h_G, 6e94_A, 8gh6_A, 7y3m_I, 7ysf_A, 2jpa_A, 1ubd_C, 2kmk_A, 1tf3_A, 2wbs_A, 5k5i_A, 6u9q_A, 2lt7_A, 6jnm_A, 6a57_A, 1yuj_A, 8gn3_A, 7txc_E, 2drp_D, 3oym_A, 1dp7_P, 5yj3_D |
| Binding Motifs: | sob_SANGER_10_FBgn0004892 GCTWCTGkkktwv sob_SOLEXA_5_FBgn0004892 bkGCTACyGkkykk |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.