Transcription Factor
| Accessions: | T07497 (AthalianaCistrome v4_May2016), Q9SI15 (JASPAR 2024), AtbZIP2 (EEADannot 2025-01-07) |
| Names: | AT2G18160, GBF5, T07497;, AtbZIP2, bZIP transcription factor 2, BZIP2_ARATH, G-box-binding factor 5, Protein FLORAL TRANSITION AT THE MERISTEM 3, Q9SI15;BZIP2_ARATH;AT2G18160.1 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | AthalianaCistrome v4_May2016 1, JASPAR 2024 2, EEADannot 2025-01-07 3 1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 3 Contreras-Moreira B, Sebastian A. FootprintDB: Analysis of Plant Cis-Regulatory Elements, Transcription Factors, and Binding Interfaces. Methods Mol Biol 1482:259-77 (2016) [Pubmed] |
| Notes: | ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:bZIP, family:Basic leucine zipper factors (bZIP) bZIP |
| Length: | 171 |
| Pfam Domains: | 28-75 Basic region leucine zipper 31-87 bZIP transcription factor |
| Sequence: | MASSSSTYRSSSSSDGGNNNPSDSVVTVDERKRKRMLSNRESARRSRMRKQKHVDDLTAQ INQLSNDNRQILNSLTVTSQLYMKIQAENSVLTAQMEELSTRLQSLNEIVDLVQSNGAGF GVDQIDGCGFDDRTVGIDGYYDDMNMMSNVNHWGGSVYTNQPIMANDINMY |
| Binding Motifs: | M0207 dwwGcTGACGTGGCa M0215 dwwGcTGACGTGGCa MA1743.1 dwwGcTGACGTGGCa MA1743.2 wGcTGACGTGGCa EEAD0096 dwwgswsACGTGGCA EEAD0097 kmCACGTs EEAD0114 tGmCACGTsd EEAD0115 tGmTGACkyrg EEAD0116 kvwsACGTGKm EEAD0117 TGmTGACkyrg EEAD0118 mwsACGTGKCa EEAD0119 tGmTGAcgTGG |
| Publications: | Martinez-Garcia J. F., Moyano E., Alcocer M. J. C., Martin C. Two bZIP proteins from Antirrhinum flowers preferentially bind a hybrid C-box/G-box motif and help to define a new sub-family of bZIP transcription factors.. Plant J. 13:489-505 (1998). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.