Transcription Factor
| Accessions: | 3mfk_B (3D-footprint 20250804), 3ri4_D (3D-footprint 20250804) |
| Names: | ETS1_HUMAN, p54, Protein C-ets-1 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P14921 |
| Length: | 136 |
| Pfam Domains: | 34-115 Ets-domain |
| Sequence: (in bold interface residues) | 1 GTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGW 60 61 EFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSL 120 121 LGYTPEELHAMLDVKP |
| Interface Residues: | 31, 64, 68, 69, 72, 86, 87, 89, 90, 91, 93, 94, 108 |
| 3D-footprint Homologues: | 3zp5_A, 2wbs_A, 8ee9_F, 4mhg_A, 2stt_A, 8smh_F, 4uno_A, 8smj_F, 1dux_F, 7jsa_J, 3jtg_A, 1awc_A, 4iri_A, 1bc8_C, 4l18_B, 4lg0_B, 1yo5_C |
| Binding Motifs: | 3mfk_AB AGGAagnnnnTCC 3mfk_B tTCCt 3ri4_D CATCCT |
| Binding Sites: | 3mfk_C 3mfk_D 3ri4_E 3ri4_F |
| Publications: | Babayeva N.D, Wilder P.J, Shiina M, Mino K, Desler M, Ogata K, Rizzino A, Tahirov T.H. Structural basis of Ets1 cooperative binding to palindromic sequences on stromelysin-1 promoter DNA. Cell cycle (Georgetown, Tex.) 9:3054-62 (2010). [Pubmed] Babayeva N.D, Baranovskaya O.I, Tahirov T.H. Structural basis of Ets1 cooperative binding to widely separated sites on promoter DNA. PloS one 7:e33698 (2012). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.