Transcription Factor
| Accessions: | 6fix_E (3D-footprint 20231221) |
| Names: | A0A179R2V1_PSEPU, XRE family transcriptional regulator |
| Organisms: | Pseudomonas putida |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | A0A179 |
| Length: | 92 |
| Pfam Domains: | 14-63 Helix-turn-helix |
| Sequence: (in bold interface residues) | 1 RPIHPGEILREEFQKEMGFSAAALARALGVATPTVNNILRERGGVSADMALRLSICLDTT 60 61 PEFWLNLQTAFDLRTAEQQHGDEIIGSVQRLV |
| Interface Residues: | 21, 22, 31, 32, 33, 34, 36, 37, 40, 42, 43 |
| 3D-footprint Homologues: | 2r1j_L, 6chv_D, 6fix_D, 3zkc_A, 4lln_I, 7csw_B |
| Binding Motifs: | 6fix_ABDE ACnnnTaAnnTTAAnnnTT |
| Binding Sites: | 6fix_C 6fix_F |
| Publications: | Talavera A, Tamman H, Ainelo A, Konijnenberg A, Hadži S, Sobott F, Garcia-Pino A, Hõrak R, Loris R. A dual role in regulation and toxicity for the disordered N-terminus of the toxin GraT. Nat Commun 10:972 (2019). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.