Transcription Factor

Accessions: FOS_TF1 (HumanTF2 1.0), FOS (HT-SELEX2 May2017)
Names: Cellular oncogene fos, FOS, FOS_HUMAN, G0/G1 switch regulatory protein 7, Proto-oncogene c-Fos, ENSG00000170345
Organisms: Homo sapiens
Libraries: HumanTF2 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: P01100
Notes: Ensembl ID: ENSG00000170345; Construct type: TF1(SBP); TF family: bZIP; Clone source: MGC, TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 142
Pfam Domains: 62-121 bZIP transcription factor
64-116 Basic region leucine zipper
Sequence:
(in bold interface residues)
1 QWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLS 60
61 PEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKL 120
121 EFILAAHRPACKIPDDLGFPEE
Interface Residues: 70, 71, 74, 75, 77, 78, 81, 82, 85
3D-footprint Homologues: 7x5e_E, 7x5e_F, 2wt7_A, 6mg1_B, 1skn_P, 4eot_A, 5vpe_C, 5vpe_D
Binding Motifs: FOS bgATGACGTCATCr
FOS_2 gATGACGTCAyc
FOS_methyl_1 gATGAyGTCATc
Publications: Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.