Transcription Factor
| Accessions: | FOS_TF1 (HumanTF2 1.0), FOS (HT-SELEX2 May2017) |
| Names: | Cellular oncogene fos, FOS, FOS_HUMAN, G0/G1 switch regulatory protein 7, Proto-oncogene c-Fos, ENSG00000170345 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF2 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | P01100 |
| Notes: | Ensembl ID: ENSG00000170345; Construct type: TF1(SBP); TF family: bZIP; Clone source: MGC, TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3 |
| Length: | 142 |
| Pfam Domains: | 62-121 bZIP transcription factor 64-116 Basic region leucine zipper |
| Sequence: (in bold interface residues) | 1 QWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLS 60 61 PEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKL 120 121 EFILAAHRPACKIPDDLGFPEE |
| Interface Residues: | 70, 71, 74, 75, 77, 78, 81, 82, 85 |
| 3D-footprint Homologues: | 7x5e_E, 7x5e_F, 2wt7_A, 6mg1_B, 1skn_P, 4eot_A, 5vpe_C, 5vpe_D |
| Binding Motifs: | FOS bgATGACGTCATCr FOS_2 gATGACGTCAyc FOS_methyl_1 gATGAyGTCATc |
| Publications: | Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.