Transcription Factor

Accessions: 5yi2_A (3D-footprint 20231221), 5yi2_E (3D-footprint 20231221)
Names: Q9CDU5_LACLA, Zinc transport transcriptional regulator
Organisms: Lactococcus lactis, Lactococcus lactis subsp. lactis (strain IL1403)
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 146
Pfam Domains: 36-91 MarR family
36-93 MarR family
37-82 Winged helix-turn-helix DNA-binding
37-100 Winged helix DNA-binding domain
42-85 Transcriptional regulator
42-83 Bacterial regulatory protein, arsR family
43-115 TFIIE alpha subunit
43-82 Iron dependent repressor, N-terminal DNA binding domain
Sequence:
(in bold interface residues)
1 GMSLANQIDQFLGTIMQFAENKHEILLGKCESDVKLTSTQEHILMLLAEQISTNAKIAEK 60
61 LKISPAAVTKALKKLQEQELIKSSRATNDERVVLWSLTEKAVPVAKEHATHHEKTLSTYQ 120
121 ELGNKFTDEEQEVISKFLSALTEEFQ
Interface Residues: 37, 39, 54, 64, 65, 66, 67, 69, 70, 71, 74, 91
3D-footprint Homologues: 4kdp_B, 7el3_B, 5yi2_J, 6c2s_C, 1z9c_A, 6jbx_A, 3q5f_A, 5hlg_E, 3zpl_B, 8c7s_A, 4aik_A
Binding Motifs: 5yi2_AB TTaAAnAGTTAAA
5yi2_EF TtaACnAGTTAA
Publications: Zhu R, Song Y, Liu H, Yang Y, Wang S, Yi C, Chen PR. Allosteric histidine switch for regulation of intracellular zinc(II) fluctuation. Proc Natl Acad Sci U S A 114:13661-13666 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.