Transcription Factor
| Accessions: | 5yi2_A (3D-footprint 20250804), 5yi2_E (3D-footprint 20250804) |
| Names: | Q9CDU5_LACLA, Zinc transport transcriptional regulator |
| Organisms: | Lactococcus lactis, Lactococcus lactis subsp. lactis (strain IL1403) |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Length: | 146 |
| Pfam Domains: | 36-91 MarR family 36-93 MarR family 37-82 Winged helix-turn-helix DNA-binding 37-100 Winged helix DNA-binding domain 42-85 Transcriptional regulator 42-83 Bacterial regulatory protein, arsR family 43-115 TFIIE alpha subunit 43-82 Iron dependent repressor, N-terminal DNA binding domain |
| Sequence: (in bold interface residues) | 1 GMSLANQIDQFLGTIMQFAENKHEILLGKCESDVKLTSTQEHILMLLAEQISTNAKIAEK 60 61 LKISPAAVTKALKKLQEQELIKSSRATNDERVVLWSLTEKAVPVAKEHATHHEKTLSTYQ 120 121 ELGNKFTDEEQEVISKFLSALTEEFQ |
| Interface Residues: | 37, 39, 54, 64, 65, 66, 67, 69, 70, 71, 74, 86, 91 |
| 3D-footprint Homologues: | 4kdp_B, 7el3_B, 8pw0_A, 3q5f_A, 9c4c_G, 5yi2_J, 6c2s_C, 1z9c_A, 6jbx_A, 5hlg_E, 3zpl_B, 8c7s_A, 4aik_A |
| Binding Motifs: | 5yi2_AB TTaAAnAGTTAAA 5yi2_EF TtaACnAGTTAA |
| Publications: | Zhu R, Song Y, Liu H, Yang Y, Wang S, Yi C, Chen PR. Allosteric histidine switch for regulation of intracellular zinc(II) fluctuation. Proc Natl Acad Sci U S A 114:13661-13666 (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.