Transcription Factor

Accessions: 9ant_B (3D-footprint 20250804)
Names: ANTENNAPEDIA HOMEODOMAIN, ANTP_DROME
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P02833
Length: 56
Pfam Domains: 1-54 Homeobox domain
Sequence:
(in bold interface residues)
1 RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN
Interface Residues: 1, 24, 39, 40, 42, 43, 46, 47, 49, 50, 51, 54
3D-footprint Homologues: 2hdd_A, 8osb_E, 7q3o_C, 1b72_A, 4cyc_A, 2r5y_A, 1puf_A, 8eml_B, 1ig7_A, 6es3_K, 5flv_I, 3d1n_M, 2hos_A, 8pmf_A, 5zfz_A, 1jgg_B, 6m3d_C, 5hod_A, 3lnq_A, 2ld5_A, 9b8u_A, 5zjt_E, 3a01_E, 8ik5_C, 7psx_B, 5jlw_D, 3rkq_B, 8ejp_B, 1fjl_B, 6a8r_A, 4xrs_G, 3cmy_A, 5trd_B, 1le8_A, 7xrc_C, 4j19_B, 2xsd_C, 1e3o_C, 1au7_A, 1mnm_C, 1du0_A, 1puf_B, 8g87_X, 1nk2_P, 8bx1_A, 4qtr_D, 1zq3_P, 1k61_B, 2lkx_A, 1o4x_A
Binding Motifs: 9ant_B CTAATAG
Binding Sites: 9ant_E
9ant_F
Publications: Fraenkel E, Pabo C.O. Comparison of X-ray and NMR structures for the Antennapedia homeodomain-DNA complex. Nature structural biology 5:692-7 (1998). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.