Transcription Factor
| Accessions: | 9ant_B (3D-footprint 20231221) |
| Names: | ANTENNAPEDIA HOMEODOMAIN, ANTP_DROME |
| Organisms: | Drosophila melanogaster |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P02833 |
| Length: | 56 |
| Pfam Domains: | 1-54 Homeobox domain |
| Sequence: (in bold interface residues) | 1 RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN |
| Interface Residues: | 1, 24, 39, 40, 42, 43, 46, 47, 50, 51, 54 |
| 3D-footprint Homologues: | 1b72_A, 5hod_A, 3lnq_A, 1puf_A, 1ig7_A, 5zjt_E, 3cmy_A, 2hdd_A, 7psx_B, 5jlw_D, 3rkq_B, 2r5y_A, 1jgg_B, 6a8r_A, 4xrs_G, 3d1n_M, 2hos_A, 7q3o_C, 4cyc_A, 6es3_K, 5flv_I, 2ld5_A, 1fjl_B, 5zfz_A, 3a01_E, 2h1k_B, 6m3d_C, 5trd_B, 1e3o_C, 2xsd_C, 1au7_A, 7xrc_C, 4j19_B, 1le8_A, 2lkx_A, 8g87_X, 4qtr_D, 1mnm_C, 1du0_A, 1puf_B, 1nk2_P, 1zq3_P, 1k61_B, 3l1p_A, 1o4x_A |
| Binding Motifs: | 9ant_B CTAATAG |
| Binding Sites: | 9ant_E 9ant_F |
| Publications: | Fraenkel E, Pabo C.O. Comparison of X-ray and NMR structures for the Antennapedia homeodomain-DNA complex. Nature structural biology 5:692-7 (1998). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.