Transcription Factor
| Accessions: | 1f2i_K (3D-footprint 20250804) |
| Names: | Early growth response protein 1, EGR-1, EGR1_MOUSE, FUSION OF N-TERMINAL 17-MER PEPTIDE EXTENSION TO ZIF12, Nerve growth factor-induced protein A, NGFI-A, Transcription factor Zif268, Zinc finger protein Krox-24 |
| Organisms: | Mus musculus |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P08046 |
| Length: | 63 |
| Pfam Domains: | 10-34 Zinc finger, C2H2 type 10-34 C2H2-type zinc finger 27-50 Zinc-finger double domain 40-62 Zinc finger, C2H2 type 40-62 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 NYVVPKMRPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 60 61 THT |
| Interface Residues: | 21, 22, 23, 24, 25, 26, 28, 29, 30, 50, 51, 52, 53, 54, 55, 56, 57, 58, 61 |
| 3D-footprint Homologues: | 8gn3_A, 1tf3_A, 8cuc_F, 7y3l_A, 7n5w_A, 6jnm_A, 3uk3_C, 2kmk_A, 7ysf_A, 2drp_D, 8ssq_A, 7w1m_H, 6blw_A, 5k5l_F, 2lt7_A, 6u9q_A, 4x9j_A, 2gli_A, 8ssu_A, 1f2i_J, 5kkq_D, 2wbs_A, 1tf6_A, 5ei9_F, 2jpa_A, 1g2f_F, 5kl3_A, 1ubd_C, 7txc_E, 5k5i_A, 1llm_D, 6ml4_A, 5v3j_F, 4m9v_C, 8h9h_G, 6e94_A, 7y3m_I, 6a57_A, 5yel_A, 5yj3_D |
| Binding Motifs: | 1f2i_KL tGGGCGCGCCCa |
| Publications: | Wang B.S, Grant R.A, Pabo C.O. Selected peptide extension contacts hydrophobic patch on neighboring zinc finger and mediates dimerization on DNA. Nature structural biology 8:589-93 (2001). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.