Transcription Factor

Accessions: 1f2i_K (3D-footprint 20260701)
Names: Early growth response protein 1, EGR-1, EGR1_MOUSE, FUSION OF N-TERMINAL 17-MER PEPTIDE EXTENSION TO ZIF12, Nerve growth factor-induced protein A, NGFI-A, Transcription factor Zif268, Zinc finger protein Krox-24
Organisms: Mus musculus
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P08046
Length: 63
Pfam Domains: 10-34 C2H2-type zinc finger
10-34 Zinc finger, C2H2 type
27-50 Zinc-finger double domain
40-62 Zinc finger, C2H2 type
40-62 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 NYVVPKMRPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 60
61 THT
Interface Residues: 21, 22, 23, 24, 25, 26, 28, 29, 30, 50, 51, 52, 53, 54, 55, 56, 57, 58, 61
3D-footprint Homologues: 8gn3_A, 7n5w_A, 6jnm_A, 3uk3_C, 2kmk_A, 7ysf_A, 1tf3_A, 8cuc_F, 7y3l_A, 2wbs_A, 1tf6_A, 5ei9_F, 2jpa_A, 1g2f_F, 5kl3_A, 1ubd_C, 7txc_E, 5k5i_A, 1llm_D, 6ml4_A, 5v3j_F, 2drp_D, 8ssq_A, 7w1m_H, 6blw_A, 5k5l_F, 2lt7_A, 6u9q_A, 4x9j_A, 2gli_A, 8ssu_A, 1f2i_J, 5kkq_D, 8h9h_G, 4m9v_C, 7y3m_I, 6e94_A, 6a57_A, 5yj3_D, 5yel_A
Binding Motifs: 1f2i_KL tGGGCGCGCCCa
Publications: Wang B.S, Grant R.A, Pabo C.O. Selected peptide extension contacts hydrophobic patch on neighboring zinc finger and mediates dimerization on DNA. Nature structural biology 8:589-93 (2001). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.