Transcription Factor

						

			
Accessions: 5gnj_A (3D-footprint 20231221)

			
Names: AtbHLH6, AtMYC2, Basic helix-loop-helix protein 6, bHLH 6, bHLH transcription factor bHLH006, MYC2_ARATH, Protein JASMONATE INSENSITIVE 1, R-homologous Arabidopsis protein 1, RAP-1, rd22BP1, Transcription factor EN 38, Transcription factor MYC2, Z-box binding factor 1 protein
Organisms: Arabidopsis thaliana
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q39204
Length: 74
Pfam Domains:      1-46 Helix-loop-helix DNA-binding domain
Sequence: 
(in bold interface residues)		   1 NHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQI   60
  61 KNQLEEVKLELAGR
Interface Residues: 2, 3, 5, 6, 9, 10, 14, 30, 32
3D-footprint Homologues: 7xq5_A, 4h10_A, 7rcu_E, 5gnj_I, 5v0l_A, 4zpk_A, 7ssa_L, 5i50_B, 6g1l_A, 7xi3_A, 5nj8_D, 7d8t_A, 5eyo_A, 8osl_P, 1an4_A, 5sy7_B, 7z5k_B, 4zpr_B
Binding Motifs: 5gnj_AB taCACGTG
			
Publications: Lian TF, Xu YP, Li LF, Su XD. Crystal Structure of Tetrameric Arabidopsis MYC2 Reveals the Mechanism of Enhanced Interaction with DNA. Cell Rep 19:1334-1342 (2017). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.