Transcription Factor

						

			
Accessions: 1h9d_A (3D-footprint 20231221)

			
Names: Acute myeloid leukemia 1 protein, CBF-alpha-2, CORE-BINDING FACTOR ALPHA SUBUNIT1, Core-binding factor subunit alpha-2, Oncogene AML-1, PEA2-alpha B, PEBP2-alpha B, Polyomavirus enhancer-binding protein 2 alpha B subunit, Runt-related transcription factor 1, RUNX1_HUMAN, SL3-3 enhancer factor 1 alpha B subunit, SL3/AKV core-binding factor alpha B subunit
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q01196
Length: 125
Pfam Domains:     2-125 Runt domain
Sequence: 
(in bold interface residues)		   1 VLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENY   60
  61 SAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGP  120
 121 REPRR
Interface Residues: 27, 89, 117, 118, 121, 124
3D-footprint Homologues: 4l0y_A, 4l18_E, 6vg8_D, 3wts_A, 6vgd_D
Binding Motifs: 1h9d_A tGCGGTtG
Binding Sites: 1h9d_E
1h9d_F
			
Publications: Bravo J, Li Z, Speck N.A, Warren A.J. The leukemia-associated AML1 (Runx1)--CBF beta complex functions as a DNA-induced molecular clamp. Nature structural biology 8:371-8 (2001). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.