Transcription Factor

Accessions: 1cma_A (3D-footprint 20260701), 1cma_B (3D-footprint 20260701)
Names: Met regulon regulatory protein MetJ, MET REPRESSOR, METJ_ECOLI
Organisms: Escherichia coli, strain K12
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0A8U6
Length: 104
Pfam Domains: 1-104 Met Apo-repressor, MetJ
Sequence:
(in bold interface residues)
1 AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEA 60
61 FLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY
Interface Residues: 2, 3, 7, 8, 23, 25, 42, 66
3D-footprint Homologues: 6crm_A, 1mjo_B, 6mrj_D, 1zgw_A
Binding Motifs: 1cma_AB kGannTC
Binding Sites: 1cma_C
1cma_D
Publications: Somers WS., Phillips SE. Crystal structure of the met repressor-operator complex at 2.8 A resolution reveals DNA recognition by beta-strands. Nature. 359(6394):387-93 (1992). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.