Transcription Factor
Accessions: | 1cma_A (3D-footprint 20231221), 1cma_B (3D-footprint 20231221) |
Names: | Met regulon regulatory protein MetJ, MET REPRESSOR, METJ_ECOLI |
Organisms: | Escherichia coli, strain K12 |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P0A8U6 |
Length: | 104 |
Pfam Domains: | 1-104 Met Apo-repressor, MetJ |
Sequence: (in bold interface residues) | 1 AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEA 60 61 FLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY |
Interface Residues: | 2, 3, 7, 8, 23, 25, 42, 66 |
3D-footprint Homologues: | 6crm_A, 1mjo_B, 6mrj_D, 1zgw_A |
Binding Motifs: | 1cma_AB kGannTC |
Binding Sites: | 1cma_C 1cma_D |
Publications: | Somers WS., Phillips SE. Crystal structure of the met repressor-operator complex at 2.8 A resolution reveals DNA recognition by beta-strands. Nature. 359(6394):387-93 (1992). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.