Transcription Factor
| Accessions: | 5d5v_B (3D-footprint 20250804) |
| Names: | Heat shock factor protein 1, Heat shock transcription factor 1, HSF 1, HSF1_HUMAN, HSTF 1 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q00613 |
| Length: | 96 |
| Pfam Domains: | 4-95 HSF-type DNA-binding |
| Sequence: (in bold interface residues) | 1 NVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQL 60 61 NMYGFRKVVHDDTEFQHPCFLRGQEQLLENIKRKVT |
| Interface Residues: | 49, 50, 55, 57, 58, 59, 61, 62, 93 |
| 3D-footprint Homologues: | 5hdn_C, 5d5v_B, 5d5w_B, 3hts_B, 7dci_A |
| Binding Motifs: | 5d5v_B CnTTCCA 5d5v_BD GGAnTGGA |
| Binding Sites: | 5d5v_A 5d5v_C |
| Publications: | Neudegger T, Verghese J, Hayer-Hartl M, Hartl FU, Bracher A. Structure of human heat-shock transcription factor 1 in complex with DNA. Nat Struct Mol Biol 23:140-6 (2016). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.