Transcription Factor

Accessions: Q9Y2Y9 (JASPAR 2024)
Names: Basic transcription element-binding protein 3, BTE-binding protein 3, KLF13_HUMAN, Krueppel-like factor 13, Novel Sp1-like zinc finger transcription factor 1, RANTES factor of late activated T-lymphocytes 1, RFLAT-1, Transcription factor BTEB3, Transcription factor NSLP1
Organisms: Homo sapiens
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Length: 288
Pfam Domains: 167-191 C2H2-type zinc finger
167-191 Zinc finger, C2H2 type
183-209 Zinc-finger double domain
197-221 C2H2-type zinc finger
197-221 Zinc finger, C2H2 type
214-236 Zinc-finger double domain
227-249 C2H2-type zinc finger
227-249 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 MAAAAYVDHFAAECLVSMSSRAVVHGPREGPESRPEGAAVAATPTLPRVEERRDGKDSAS 60
61 LFVVARILADLNQQAPAPAPAERREGAAARKARTPCRLPPPAPEPTSPGAEGAAAAPPSP 120
121 AWSEPEPEAGLEPEREPGPAGSGEPGLRQRVRRGRSRADLESPQRKHKCHYAGCEKVYGK 180
181 SSHLKAHLRTHTGERPFACSWQDCNKKFARSDELARHYRTHTGEKKFSCPICEKRFMRSD 240
241 HLTKHARRHANFHPGMLQRRGGGSRTGSLSDYSRSDASSPTISPASSP
Interface Residues: 141, 142, 144, 152, 156, 157, 158, 159, 175, 179, 180, 181, 182, 183, 185, 186, 188, 189, 192, 208, 209, 210, 211, 212, 213, 215, 216, 217, 220, 237, 238, 239, 240, 241, 242, 243, 244, 245, 247, 248
3D-footprint Homologues: 8ssu_A, 5kkq_D, 8ssq_A, 7w1m_H, 2i13_A, 5und_A, 7n5w_A, 3uk3_C, 1tf3_A, 6jnm_A, 8cuc_F, 5k5l_F, 1tf6_A, 6ml4_A, 4x9j_A, 6blw_A, 1ubd_C, 6u9q_A, 5ei9_F, 1mey_C, 5kl3_A, 7ysf_A, 6wmi_A, 2kmk_A, 2gli_A, 1g2f_F, 7eyi_G, 8h9h_G, 2lt7_A, 7y3m_I, 6e94_A, 6a57_A, 2jpa_A, 8gn3_A, 7y3l_A, 1llm_D, 2wbs_A, 7txc_E, 2drp_D, 1f2i_J, 5k5i_A, 4m9v_C, 5yel_A, 5v3j_F, 5yj3_D
Binding Motifs: MA0657.1 rtRmCACGCCCCYTTttg
MA0657.2 tRmCACGCCCCYTTttg
Publications: Lomberk G, Urrutia R. The family feud: turning off Sp1 by Sp1-like KLF proteins. Biochem J : (2005). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.