Transcription Factor
| Accessions: | 1zs4_D (3D-footprint 20260701) |
| Names: | Regulatory protein CII, RPC2_LAMBD |
| Organisms: | Enterobacteria phage lambda, Escherichia phage lambda |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P03042 |
| Length: | 73 |
| Pfam Domains: | 1-73 Bacteriophage CII protein |
| Sequence: (in bold interface residues) | 1 RNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKRDWIPKFSMLLAVLEWGVVDDD 60 61 MARLARQVAAILT |
| Interface Residues: | 20, 21, 30, 31, 32, 33, 35, 36 |
| 3D-footprint Homologues: | 8igr_C |
| Binding Motifs: | 1zs4_ACD GTTGCgnnnnTTTGCa |
| Binding Sites: | 1zs4_T 1zs4_U |
| Publications: | Jain D, Kim Y, Maxwell K.L, Beasley S, Zhang R, Gussin G.N, Edwards A.M, Darst S.A. Crystal structure of bacteriophage lambda cII and its DNA complex. Molecular cell 19:259-69 (2005). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.